You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethionine aminopeptidase 1
Synonyms
  • MAP 1
  • MetAP 1
  • Peptidase M 1
Gene NameMAP1
Enzyme Class
Biological Properties
General FunctionInvolved in aminopeptidase activity
Specific FunctionRemoves the amino-terminal methionine from nascent proteins
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00318L-MethionineShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
exopeptidase activity
aminopeptidase activity
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on L-amino acid peptides
metallopeptidase activity
metalloexopeptidase activity
Process
metabolic process
macromolecule metabolic process
cellular process
protein metabolic process
proteolysis
Gene Properties
Chromosome Locationchromosome 12
LocusYLR244C
Gene Sequence>1164 bp ATGAGCACTGCAACTACAACAGTTACTACCTCCGATCAGGCTTCTCATCCTACCAAGATA TATTGCTCCGGTTTGCAATGTGGTAGAGAAACTTCGTCCCAAATGAAATGCCCTGTTTGT CTAAAACAAGGCATCGTTTCCATTTTCTGCGACACAAGCTGTTATGAAAACAACTACAAA GCTCACAAAGCTTTGCACAATGCTAAGGACGGCTTGGAAGGTGCTTATGATCCTTTCCCA AAATTCAAATATTCTGGTAAAGTGAAGGCTTCATATCCACTTACCCCAAGAAGGTATGTC CCTGAAGATATTCCTAAACCGGACTGGGCCGCTAATGGGCTACCAGTCAGTGAACAAAGA AATGATAGACTTAACAACATCCCTATATACAAGAAAGATCAAATTAAGAAGATTAGAAAG GCATGTATGTTGGGTAGAGAAGTTCTTGATATTGCCGCTGCCCATGTCAGACCAGGCATC ACTACAGATGAATTAGATGAAATCGTCCACAATGAAACAATTAAGAGAGGTGCCTACCCT TCCCCTCTTAATTATTACAACTTTCCTAAATCGCTTTGTACCTCTGTCAATGAAGTTATT TGTCACGGTGTGCCCGATAAAACTGTCTTGAAGGAAGGTGATATTGTCAATTTAGATGTT TCCTTATACTACCAAGGTTATCATGCAGACTTGAATGAGACATATTATGTCGGCGAAAAC ATTTCTAAGGAAGCTCTTAATACTACTGAGACCTCAAGAGAATGTTTGAAACTAGCCATT AAAATGTGTAAGCCAGGTACCACCTTCCAAGAGTTAGGTGATCATATTGAAAAACACGCT ACCGAAAATAAGTGCAGTGTAGTAAGAACTTATTGTGGACATGGTGTTGGTGAATTTTTC CATTGTTCCCCAAATATTCCCCACTACGCCAAGAATAGAACACCTGGTGTTATGAAACCA GGTATGGTTTTCACCATCGAACCTATGATTAATGAAGGTACTTGGAAGGATATGACCTGG CCTGATGACTGGACTTCTACCACCCAAGACGGTAAACTGAGTGCTCAATTTGAACATACA CTGTTGGTTACCGAACATGGTGTTGAAATCCTAACAGCCAGGAATAAGAAATCACCAGGT GGCCCAAGACAGAGAATTAAATAG
Protein Properties
Pfam Domain Function
Protein Residues387
Protein Molecular Weight43373.0
Protein Theoretical pI7.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methionine aminopeptidase 1 MSTATTTVTTSDQASHPTKIYCSGLQCGRETSSQMKCPVCLKQGIVSIFCDTSCYENNYK AHKALHNAKDGLEGAYDPFPKFKYSGKVKASYPLTPRRYVPEDIPKPDWAANGLPVSEQR NDRLNNIPIYKKDQIKKIRKACMLGREVLDIAAAHVRPGITTDELDEIVHNETIKRGAYP SPLNYYNFPKSLCTSVNEVICHGVPDKTVLKEGDIVNLDVSLYYQGYHADLNETYYVGEN ISKEALNTTETSRECLKLAIKMCKPGTTFQELGDHIEKHATENKCSVVRTYCGHGVGEFF HCSPNIPHYAKNRTPGVMKPGMVFTIEPMINEGTWKDMTWPDDWTSTTQDGKLSAQFEHT LLVTEHGVEILTARNKKSPGGPRQRIK
References
External Links
ResourceLink
Saccharomyces Genome Database MAP1
Uniprot IDQ01662
Uniprot NameAMPM1_YEAST
GenBank Gene IDM77092
Genebank Protein ID975723
General Reference
  • Chang, Y. H., Teichert, U., Smith, J. A. (1992). "Molecular cloning, sequencing, deletion, and overexpression of a methionine aminopeptidase gene from Saccharomyces cerevisiae." J Biol Chem 267:8007-8011.1569059
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Walker, K. W., Bradshaw, R. A. (1998). "Yeast methionine aminopeptidase I can utilize either Zn2+ or Co2+ as a cofactor: a case of mistaken identity?" Protein Sci 7:2684-2687.9865965
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106