You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamemRNA-capping enzyme subunit alpha
Synonyms
  • GTP--RNA guanylyltransferase
  • GTase
  • mRNA guanylyltransferase
Gene NameCEG1
Enzyme Class
Biological Properties
General FunctionInvolved in mRNA guanylyltransferase activity
Specific FunctionSecond step of mRNA capping. Transfer of the GMP moiety of GTP to the 5'-end of RNA via an enzyme-GMP covalent reaction intermediate
Cellular LocationNucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00558GTPShow
GO Classification
Component
methyltransferase complex
mRNA cap methyltransferase complex
macromolecular complex
protein complex
Function
transferase activity, transferring phosphorus-containing groups
binding
nucleotidyltransferase activity
protein binding
guanylyltransferase activity
catalytic activity
RNA guanylyltransferase activity
transferase activity
mRNA guanylyltransferase activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
RNA processing
mRNA processing
mRNA capping
Gene Properties
Chromosome Locationchromosome 7
LocusYGL130W
Gene Sequence>1380 bp ATGGTTTTAGCAATGGAAAGTAGAGTGGCACCGGAAATTCCTGGGCTCATTCAACCTGGG AATGTCACGCAAGACTTGAAGATGATGGTCTGTAAATTATTGAATTCCCCAAAACCTACG AAAACATTCCCTGGTTCCCAGCCTGTGTCCTTTCAGCATTCTGATGTGGAAGAGAAGCTG CTTGCGCATGATTACTACGTTTGTGAGAAAACAGATGGTCTGCGGGTGTTGATGTTTATA GTGATAAATCCTGTGACGGGTGAGCAAGGATGCTTTATGATTGATAGGGAAAATAACTAT TATCTGGTTAATGGATTTAGGTTTCCCAGATTACCCCAAAAGAAGAAAGAAGAGCTGCTA GAGACTCTTCAAGATGGCACCTTATTAGATGGTGAACTTGTCATACAAACTAACCCAATG ACAAAATTACAAGAGTTGCGTTATTTAATGTTCGATTGTCTTGCTATCAATGGTAGATGT CTCACACAATCACCAACAAGTTCTAGACTAGCCCACCTTGGAAAAGAATTTTTTAAACCA TACTTCGATTTAAGAGCAGCGTACCCTAATCGTTGTACTACTTTTCCGTTCAAAATTTCC ATGAAACATATGGATTTCAGTTACCAATTAGTAAAAGTTGCTAAAAGTTTAGATAAACTA CCACATCTTTCTGATGGTCTGATATTTACTCCTGTGAAGGCACCTTACACTGCCGGCGGA AAAGATTCATTGTTATTAAAATGGAAGCCAGAACAAGAAAACACCGTGGACTTCAAATTG ATTTTAGATATCCCAATGGTGGAGGATCCTTCTTTGCCTAAAGATGATCGGAACAGGTGG TATTACAATTATGACGTTAAGCCAGTTTTCAGCTTATATGTCTGGCAAGGCGGAGCTGAT GTCAATTCACGTTTAAAACATTTCGACCAGCCTTTCGATAGGAAGGAATTTGAAATATTA GAAAGAACATACAGAAAATTTGCAGAGTTGAGCGTTTCAGATGAGGAATGGCAAAATTTG AAGAACCTAGAACAGCCATTAAATGGTAGAATAGTAGAGTGCGCAAAAAACCAAGAGACT GGGGCGTGGGAAATGTTAAGATTCAGGGATGATAAGTTAAATGGTAATCATACATCGGTG GTCCAGAAAGTTTTGGAGAGTATCAACGATTCAGTTTCATTGGAGGACCTCGAGGAAATT GTTGGTGATATTAAAAGGTGCTGGGACGAGAGAAGAGCAAATATGGCTGGTGGTAGTGGG AGACCACTACCGTCTCAAAGTCAAAATGCGACATTATCTACCTCTAAGCCAGTCCATTCA CAGCCCCCAAGTAATGATAAGGAGCCAAAATATGTAGACGAGGATGATTGGTCGGATTAG
Protein Properties
Pfam Domain Function
Protein Residues459
Protein Molecular Weight52763.80078
Protein Theoretical pI5.56
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>mRNA-capping enzyme subunit alpha MVLAMESRVAPEIPGLIQPGNVTQDLKMMVCKLLNSPKPTKTFPGSQPVSFQHSDVEEKL LAHDYYVCEKTDGLRVLMFIVINPVTGEQGCFMIDRENNYYLVNGFRFPRLPQKKKEELL ETLQDGTLLDGELVIQTNPMTKLQELRYLMFDCLAINGRCLTQSPTSSRLAHLGKEFFKP YFDLRAAYPNRCTTFPFKISMKHMDFSYQLVKVAKSLDKLPHLSDGLIFTPVKAPYTAGG KDSLLLKWKPEQENTVDFKLILDIPMVEDPSLPKDDRNRWYYNYDVKPVFSLYVWQGGAD VNSRLKHFDQPFDRKEFEILERTYRKFAELSVSDEEWQNLKNLEQPLNGRIVECAKNQET GAWEMLRFRDDKLNGNHTSVVQKVLESINDSVSLEDLEEIVGDIKRCWDERRANMAGGSG RPLPSQSQNATLSTSKPVHSQPPSNDKEPKYVDEDDWSD
References
External Links
ResourceLink
Saccharomyces Genome Database CEG1
Uniprot IDQ01159
Uniprot NameMCE1_YEAST
GenBank Gene IDD10263
Genebank Protein ID529647
General Reference
  • Shibagaki, Y., Itoh, N., Yamada, H., Nagata, S., Mizumoto, K. (1992). "mRNA capping enzyme. Isolation and characterization of the gene encoding mRNA guanylytransferase subunit from Saccharomyces cerevisiae." J Biol Chem 267:9521-9528.1315757
  • Yamagishi, M., Mizumoto, K., Ishihama, A. (1995). "Isolation of temperature-sensitive mutants for mRNA capping enzyme in Saccharomyces cerevisiae." Mol Gen Genet 249:147-154.7500935
  • Rodriguez-Belmonte, E., Rodriguez-Torres, A. M., Tizon, B., Cadahia, J. L., Gonzalez-Siso, I., Ramil, E., Becerra, M., Gonzalez-Dominguez, M., Cerdan, E. (1996). "Sequence analysis of a 10 kb DNA fragment from yeast chromosome VII reveals a novel member of the DnaJ family." Yeast 12:145-148.8686378
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Shuman, S., Liu, Y., Schwer, B. (1994). "Covalent catalysis in nucleotidyl transfer reactions: essential motifs in Saccharomyces cerevisiae RNA capping enzyme are conserved in Schizosaccharomyces pombe and viral capping enzymes and among polynucleotide ligases." Proc Natl Acad Sci U S A 91:12046-12050.7991582
  • Fresco, L. D., Buratowski, S. (1994). "Active site of the mRNA-capping enzyme guanylyltransferase from Saccharomyces cerevisiae: similarity to the nucleotidyl attachment motif of DNA and RNA ligases." Proc Natl Acad Sci U S A 91:6624-6628.8022828
  • Itoh, N., Mizumoto, K., Kaziro, Y. (1984). "Messenger RNA guanylyltransferase from Saccharomyces cerevisiae. I. Purification and subunit structure." J Biol Chem 259:13923-13929.6389537
  • Itoh, N., Mizumoto, K., Kaziro, Y. (1984). "Messenger RNA guanlyltransferase from Saccharomyces cerevisiae. II. Catalytic properties." J Biol Chem 259:13930-13936.6094533
  • Itoh, N., Yamada, H., Kaziro, Y., Mizumoto, K. (1987). "Messenger RNA guanylyltransferase from Saccharomyces cerevisiae. Large scale purification, subunit functions, and subcellular localization." J Biol Chem 262:1989-1995.3029058
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106