ATP synthase subunit J, mitochondrial (P81450)

Identification
NameATP synthase subunit J, mitochondrial
Synonyms
  • ATPase synthase I subunit
Gene NameATP18
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in hydrogen ion transmembrane transporter acti
Specific FunctionMitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane
Cellular LocationMitochondrion membrane; Single-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Component
proton-transporting ATP synthase complex, coupling factor F(o)
macromolecular complex
protein complex
proton-transporting two-sector ATPase complex, proton-transporting domain
Function
hydrogen ion transmembrane transporter activity
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
metabolic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
ATP synthesis coupled proton transport
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>180 bp ATGTTGAAAAGATTCCCTACCCCTATCCTTAAAGTATACTGGCCTTTCTTTGTGGCTGGC GCCGCAGTGTATTATGGTATGAGTAAAGCTGCTGACCTTTCTTCTAACACGAAGGAATTT ATCAATGATCCAAGAAATCCCAGATTCGCAAAAGGTGGAAAGTTTGTGGAAGTTGATTGA
Protein Properties
Pfam Domain Function
Protein Residues59
Protein Molecular Weight6687.7002
Protein Theoretical pI10.23
Signalling Regions
  • None
Transmembrane Regions
  • 9-25
Protein Sequence>ATP synthase subunit J, mitochondrial MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD
References
External Links
ResourceLink
Saccharomyces Genome Database ATP18
Uniprot IDP81450
Uniprot NameATP18_YEAST
GenBank Gene IDAF073791
Genebank Protein ID3329486
General Reference
  • Vaillier, J., Arselin, G., Graves, P. V., Camougrand, N., Velours, J. (1999). "Isolation of supernumerary yeast ATP synthase subunits e and i. Characterization of subunit i and disruption of its structural gene ATP18." J Biol Chem 274:543-548.9867878
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Arnold, I., Pfeiffer, K., Neupert, W., Stuart, R. A., Schagger, H. (1999). "ATP synthase of yeast mitochondria. Isolation of subunit j and disruption of the ATP18 gene." J Biol Chem 274:36-40.9867807
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106