Identification |
---|
Name | ATP synthase subunit 9, mitochondrial |
---|
Synonyms | - Lipid-binding protein
- Oligomycin resistance protein 1
|
---|
Gene Name | ATP9 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | Energy production and conversion |
---|
Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element |
---|
Cellular Location | Mitochondrion membrane; Multi-pass membrane protein (Potential) |
---|
SMPDB Pathways | Not Available |
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | |
---|
GO Classification | Component |
---|
macromolecular complex | protein complex | proton-transporting two-sector ATPase complex, proton-transporting domain | proton-transporting ATP synthase complex, coupling factor F(o) | Function |
---|
transporter activity | transmembrane transporter activity | substrate-specific transmembrane transporter activity | ion transmembrane transporter activity | cation transmembrane transporter activity | inorganic cation transmembrane transporter activity | monovalent inorganic cation transmembrane transporter activity | hydrogen ion transmembrane transporter activity | Process |
---|
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | nucleobase, nucleoside and nucleotide metabolic process | nucleoside phosphate metabolic process | nucleotide metabolic process | purine nucleotide metabolic process | metabolic process | purine nucleotide biosynthetic process | purine nucleoside triphosphate biosynthetic process | purine ribonucleoside triphosphate biosynthetic process | ATP biosynthetic process | ATP synthesis coupled proton transport | nitrogen compound metabolic process | cellular nitrogen compound metabolic process |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | >231 bp
ATGCAATTAGTATTAGCAGCTAAATATATTGGAGCAGGTATCTCAACAATTGGTTTATTA
GGAGCAGGTATTGGTATTGCTATCGTATTCGCAGCTTTAATTAATGGTGTATCAAGAAAC
CCATCAATTAAAGACCTAGTATTCCCTATGGCTATTTTAGGTTTCGCCTTATCAGAAGCT
ACAGGTTTATTCTGTTTAATGGTTTCATTCTTATTATTATTCGGTGTATAA |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 76 |
---|
Protein Molecular Weight | 7759.2998 |
---|
Protein Theoretical pI | 8.52 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >ATP synthase subunit 9, mitochondrial
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA
TGLFCLMVSFLLLFGV |
---|
References |
---|
External Links | |
---|
General Reference | - Hensgens, L. A., Grivell, L. A., Borst, P., Bos, J. L. (1979). "Nucleotide sequence of the mitochondrial structural gene for subunit 9 of yeast ATPase complex." Proc Natl Acad Sci U S A 76:1663-1667.156363
- Macino, G., Tzagoloff, A. (1979). "Assembly of the mitochondrial membrane system. The DNA sequence of a mitochondrial ATPase gene in Saccharomyces cerevisiae." J Biol Chem 254:4617-4623.155696
- Ooi, B. G., McMullen, G. L., Linnane, A. W., Nagley, P., Novitski, C. E. (1985). "Biogenesis of mitochondria: DNA sequence analysis of mit- mutations in the mitochondrial oli1 gene coding for mitochondrial ATPase subunit 9 in Saccharomyces cerevisiae." Nucleic Acids Res 13:1327-1339.2860638
- Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
- Michon, T., Galante, M., Velours, J. (1988). "NH2-terminal sequence of the isolated yeast ATP synthase subunit 6 reveals post-translational cleavage." Eur J Biochem 172:621-625.2894987
- Stock, D., Leslie, A. G., Walker, J. E. (1999). "Molecular architecture of the rotary motor in ATP synthase." Science 286:1700-1705.10576729
|
---|