You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable inosine-5'-monophosphate dehydrogenase IMD4
Synonyms
  • IMP dehydrogenase
  • IMPD
  • IMPDH
Gene NameIMD4
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00289Xanthylic acidShow
YMDB00352Inosinic acidShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
IMP dehydrogenase activity
catalytic activity
oxidoreductase activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYML056C
Gene Sequence>1575 bp ATGAGTGCTGCTCCATTGGATTACAAAAAGGCTTTAGAACATTTGAAGACATACAGTTCC AAGGACGGTCTTTCTGTCCAGGAATTGATGGACTCCACAACTAGAGGTGGGTTGACCTAC AATGATTTTTTGGTCTTACCAGGCTTGGTCAATTTCCCATCTTCTGCTGTCAGTTTGCAA ACCAAATTGACCAAGAAAATCACTTTGAACACTCCTTTTGTCTCTTCTCCTATGGACACA GTCACTGAAGCTGATATGGCTATTTATATGGCTTTATTGGGTGGTATTGGTTTCATCCAT CACAACTGTACTCCAAAGGAACAGGCTTCCATGGTCAAGAAAGTTAAAATGTTTGAAAAC GGTTTCATCAATTCTCCAATAGTAATTTCTCCAACCACCACTGTTGGTGAAGTTAAGGTT ATGAAGAGAAAGTTTGGTTTCTCTGGCTTCCCAGTTACTGAAGACGGTAAGTGTCCAGGT AAGTTAGTTGGGTTAGTCACCTCTCGTGATATACAATTCTTAGAAGATGATTCTTTGGTT GTTTCTGAAGTCATGACTAAAAATCCAGTTACTGGCATCAAGGGTATTACTTTGAAAGAA GGTAATGAAATCCTAAAACAAACCAAGAAAGGTAAATTGCTTATCGTTGATGATAACGGT AACCTCGTTTCCATGTTGTCAAGAGCGGATTTGATGAAGAATCAAAACTACCCGTTAGCT TCTAAATCCGCCACCACCAAGCAATTGCTATGTGGTGCTGCAATTGGTACTATCGAAGCT GATAAGGAAAGATTAAGACTATTAGTCGAAGCAGGTTTGGATGTTGTTATCTTAGATTCC TCTCAAGGTAACTCTGTTTTCCAATTGAACATGATCAAATGGATTAAAGAAACTTTCCCA GATTTGGAAATCATTGCTGGTAACGTTGCCACCAGAGAACAAGCTGCTAACTTGATTGCT GCCGGTGCCGATGGTTTAAGAATTGGTATGGGTTCTGGGTCTATTTGTATCACTCAAGAA GTTATGGCTTGTGGTAGACCACAAGGTACAGCTGTCTACAACGTTTGTCAATTTGCTAAC CAATTTGGCGTTCCATGTATGGCTGATGGTGGTGTCCAAAACATTGGCCACATCACCAAG GCTTTGGCCCTTGGTTCCTCCACCGTCATGATGGGTGGTATGTTAGCTGGTACTACCGAG TCACCAGGTGAATACTTCTACAAGGATGGTAAGAGATTGAAGGCTTATCGTGGTATGGGG TCCATTGACGCCATGCAAAAGACCGGTAACAAGGGTAATGCCTCTACTTCTCGTTATTTC TCTGAGTCAGACAGTGTCTTGGTTGCACAAGGTGTTTCTGGGGCTGTCGTAGACAAAGGT TCCATCAAGAAGTTTATTCCATATTTGTACAACGGTTTACAACATTCTTGTCAAGACATT GGTTGCGAATCTCTAACTTCATTGAAAGAGAATGTTCAAAATGGTGAAGTTAGATTTGAA TTCAGAACCGCTTCTGCTCAATTAGAAGGTGGTGTCCATAATTTGCACTCCTATGAAAAA CGTCTATACAATTGA
Protein Properties
Pfam Domain Function
Protein Residues524
Protein Molecular Weight56393.5
Protein Theoretical pI8.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable inosine-5'-monophosphate dehydrogenase IMD4 MSAAPLDYKKALEHLKTYSSKDGLSVQELMDSTTRGGLTYNDFLVLPGLVNFPSSAVSLQ TKLTKKITLNTPFVSSPMDTVTEADMAIYMALLGGIGFIHHNCTPKEQASMVKKVKMFEN GFINSPIVISPTTTVGEVKVMKRKFGFSGFPVTEDGKCPGKLVGLVTSRDIQFLEDDSLV VSEVMTKNPVTGIKGITLKEGNEILKQTKKGKLLIVDDNGNLVSMLSRADLMKNQNYPLA SKSATTKQLLCGAAIGTIEADKERLRLLVEAGLDVVILDSSQGNSVFQLNMIKWIKETFP DLEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCQFAN QFGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYKDGKRLKAYRGMG SIDAMQKTGNKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDI GCESLTSLKENVQNGEVRFEFRTASAQLEGGVHNLHSYEKRLYN
References
External Links
ResourceLink
Saccharomyces Genome Database IMD4
Uniprot IDP50094
Uniprot NameIMDH4_YEAST
GenBank Gene IDZ46729
Genebank Protein ID577140
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Zhang, Z., Dietrich, F. S. (2005). "Mapping of transcription start sites in Saccharomyces cerevisiae using 5' SAGE." Nucleic Acids Res 33:2838-2851.15905473
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956