You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA pseudouridine synthase 4
Synonyms
  • tRNA pseudouridine 55 synthase
  • Psi55 synthase
  • tRNA pseudouridylate synthase 4
  • tRNA-uridine isomerase 4
Gene NamePUS4
Enzyme Class
Biological Properties
General FunctionInvolved in RNA processing
Specific FunctionResponsible for synthesis of pseudouridine from uracil- 55 in the psi GC loop of transfer RNAs
Cellular LocationNucleus. Mitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Uracil + alpha-D-ribose 5-phosphatewater + Pseudouridine 5'-phosphate
Metabolites
YMDB IDNameView
YMDB00098UracilShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00780Pseudouridine 5'-phosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
isomerase activity
intramolecular transferase activity
nucleic acid binding
pseudouridine synthase activity
RNA binding
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
RNA modification
pseudouridine synthesis
RNA processing
Gene Properties
Chromosome Locationchromosome 14
LocusYNL292W
Gene Sequence>1212 bp ATGAATGGAATATTTGCTATTGAGAAGCCTAGCGGTATTACATCCAATCAGTTTATGCTA AAGTTGCAACATGCTTTAACTAAAAGTCAAGTATTCTCGAAGGAAATTCAAAGGGCAACA GCGGAAAGAAAGCAGCAATATGAAAAACAGACAGGTAAGAAGGCCAGCAAGAGGAAACTT CGTAAAGTCTCAAAGGTAAAGATGGGACACGGAGGCACTTTGGATCCGTTGGCCTCTGGT GTCCTGGTAATTGGGATTGGAGCGGGCACCAAAAAACTTGCAAATTATCTTTCAGGCACC GTTAAAGTCTATGAAAGTGAAGCCCTGTTTGGTGTTTCCACTACTTCAGGAGATGTAGAA GGTGAGATTTTGTCCCAGAACTCCGTTAAACATTTAAATTTCGATGATTTAAAGACTGTG GAGGAAAAATTTGTTGGACAATTAAAGCAGACGCCGCCAATATACGCAGCTTTGAAGATG GATGGCAAACCCCTGCATGAATATGCTCGAGAAGGAAAGCCTTTACCTAGAGCCATTGAG CCCAGACAAGTTACTATTTATGACTTGAAGGTGTTTTCAGACTCTCTTAAACGTGATCAT GACTATCCCTTATTGAGGCCCACTACAGAAGAAGCTGTTGATACCGTGAAAAATTTGAAT GCAAACATGCTAAACGATGTTTTATACTTTTCAAAAGAATATACAGAGAAGCACGGCCTT GATTCTGAGGTGGCAAAGGTAGAAGAACCATTTCCGCTGAGTGAACAAGAAGAGCAAGAA ATCCAAAAAGAAGGAGATTCTTATAGGGCTCCAAAATTGCACTTCAAAGCTAATGTGTCT TCTGGAACATACATAAGGTCCTTAGTGAGCGACATCGGTAAATCTATGAGGAGCTCATGT TATATGGTGAAATTGATACGTTTGCAACAGCAGGACTGGTCTCTTGAAAAAAATAATGTG TTCCAATTAACGGATTTTACTGAAAGAGACGAGAAGGTGTGGAGTAAGGTACTGGAGAAG GTTCTAGACGAGGGAGCAACTGTTGATGTTATAGAAGAGCTAAAGAAAGCAGAAAAGGAA ATACCAGCGGACGTGAAGGAATGTATAGTTTCGAGTGATCAACCTGGTGATGAGGCTACG GCTGAAACAATTGAAACTGCTAACGCCGAAGAACATTCTAATACACTAAAAAGAAAAATC GAACAGGTGTAA
Protein Properties
Pfam Domain Function
Protein Residues403
Protein Molecular Weight45273.10156
Protein Theoretical pI6.54
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA pseudouridine synthase 4 MNGIFAIEKPSGITSNQFMLKLQHALTKSQVFSKEIQRATAERKQQYEKQTGKKASKRKL RKVSKVKMGHGGTLDPLASGVLVIGIGAGTKKLANYLSGTVKVYESEALFGVSTTSGDVE GEILSQNSVKHLNFDDLKTVEEKFVGQLKQTPPIYAALKMDGKPLHEYAREGKPLPRAIE PRQVTIYDLKVFSDSLKRDHDYPLLRPTTEEAVDTVKNLNANMLNDVLYFSKEYTEKHGL DSEVAKVEEPFPLSEQEEQEIQKEGDSYRAPKLHFKANVSSGTYIRSLVSDIGKSMRSSC YMVKLIRLQQQDWSLEKNNVFQLTDFTERDEKVWSKVLEKVLDEGATVDVIEELKKAEKE IPADVKECIVSSDQPGDEATAETIETANAEEHSNTLKRKIEQV
References
External Links
ResourceLink
Saccharomyces Genome Database PUS4
Uniprot IDP48567
Uniprot NamePUS4_YEAST
GenBank Gene IDU23084
Genebank Protein ID1050870
General Reference
  • Maurer, K. C., Urbanus, J. H., Planta, R. J. (1995). "Sequence analysis of a 30 kb DNA segment from yeast chromosome XIV carrying a ribosomal protein gene cluster, the genes encoding a plasma membrane protein and a subunit of replication factor C, and a novel putative serine/threonine protein kinase gene." Yeast 11:1303-1310.8553702
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Becker, H. F., Motorin, Y., Planta, R. J., Grosjean, H. (1997). "The yeast gene YNL292w encodes a pseudouridine synthase (Pus4) catalyzing the formation of psi55 in both mitochondrial and cytoplasmic tRNAs." Nucleic Acids Res 25:4493-4499.9358157
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956