You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutathione S-transferase omega-like 1
SynonymsNot Available
Gene NameGTO1
Enzyme Class
Biological Properties
General FunctionPosttranslational modification, protein turnover, chaperones
Specific FunctionActive as '1-Cys' thiol transferase against beta- hydroxyethyl disulfide (HED), as dehydroascorbate reductase and as dimethylarsinic acid reductase, while not active against the standard GST substrate 1-chloro-2,4-dinitrobenzene (CDNB)
Cellular LocationPeroxisome
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 7
LocusYGR154C
Gene Sequence>1071 bp ATGTCAGTATCTTACAAGGGAACAATTTCTAAGACACATTCTGTTTTTAAACCAGAAAAA GGAAGGTATTATATTTACGGGGCCCTTGGGTGTCCATTCACTCATAGAGCCATTCTTGCC AGGTCTTTGAAGAAATTAGAACCTGTTCTAGGGCTTGTGTTATCTCACTGGCAATTAGAC TCCAAGGGTGCCCGTTTCTTACCTGCTCCACACCGGCCGGAAAAATATAAAGAGAGATTC TTTACTGCCACTGGTGGCATTGCTTCAGCTAAATTAGACGAATCTGAGGAGTTAGGTGAT GTGAACAATGACTCTGCAAGGTTGTTCGTGGATGGCGCTTTCGACCCGGTGGAAAATATA TCAAGGTTAAGCGAGTTGTACTACTTAAATGATCCTAAGTACCCCGGTACAAAGTTCACT GTGCCTGTTCTGTGGGATTCTAAAACAAGGAAAATTGTTAACAATGAGAGTGGCGATATC ATAAGAATTTTGAACAGTGGCGTGTTTGATGAATTTATCCAAAGCGAAGAAACGAACGTG ATTGATCTAGTTCCGCATGATTTAATAGACGAGATTGATAAGAACATCAAATGGGTTCAT CCGAAGATTAATCTTGGTGTCTATAAAGTCGGATTAGCAGAAAACGGAAAGATTTACGAA ACTGAAGTAAAAACACTGTTTGAAAACTTGCAGAAGATGGAATGTGTACTAAAAGAAAAT TATAAGCGCTTAGAGGAGCAATTCAGTGGTAACAAACAGAAAATCTTGGCTAAATATTTT GTTTTAGGACAGAGGTTAACTGAAGCGGATATCAGATTGTATCCATCAATAATTAGATTT GACGTCGTGTACGTGCAGCACTTCAAATGCAATTTGAAAACTATAAGGGATGGTTTCCCG TACCTTCATTTGTGGTTGATTAATCTATACTGGAATTACGCAGAGTTTAGATTTACTACA GATTTTAATCATATTAAGCTCTTTTACATCAGGATGGAAGTAAGTAGGAACAAGATCAAT CAGTTTGGTATAGTGCCATTAGGCCCAAAGCCTGACATTTCTAGATTATGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues356
Protein Molecular Weight41300.19922
Protein Theoretical pI9.19
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutathione S-transferase omega-like 1 MSVSYKGTISKTHSVFKPEKGRYYIYGALGCPFTHRAILARSLKKLEPVLGLVLSHWQLD SKGARFLPAPHRPEKYKERFFTATGGIASAKLDESEELGDVNNDSARLFVDGAFDPVENI SRLSELYYLNDPKYPGTKFTVPVLWDSKTRKIVNNESGDIIRILNSGVFDEFIQSEETNV IDLVPHDLIDEIDKNIKWVHPKINLGVYKVGLAENGKIYETEVKTLFENLQKMECVLKEN YKRLEEQFSGNKQKILAKYFVLGQRLTEADIRLYPSIIRFDVVYVQHFKCNLKTIRDGFP YLHLWLINLYWNYAEFRFTTDFNHIKLFYIRMEVSRNKINQFGIVPLGPKPDISRL
References
External Links
ResourceLink
Saccharomyces Genome Database GTO1
Uniprot IDP48239
Uniprot NameGTO1_YEAST
GenBank Gene IDX85807
Genebank Protein ID1045259
General Reference
  • Skala, J., Nawrocki, A., Goffeau, A. (1995). "The sequence of a 27 kb segment on the right arm of chromosome VII from Saccharomyces cerevisiae reveals MOL1, NAT2, RPL30B, RSR1, CYS4, PEM1/CHO2, NSR1 genes and ten new open reading frames." Yeast 11:1421-1427.8585325
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Garcera, A., Barreto, L., Piedrafita, L., Tamarit, J., Herrero, E. (2006). "Saccharomyces cerevisiae cells have three Omega class glutathione S-transferases acting as 1-Cys thiol transferases." Biochem J 398:187-196.16709151
  • Barreto, L., Garcera, A., Jansson, K., Sunnerhagen, P., Herrero, E. (2006). "A peroxisomal glutathione transferase of Saccharomyces cerevisiae is functionally related to sulfur amino acid metabolism." Eukaryot Cell 5:1748-1759.16936141