You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethylthioribulose-1-phosphate dehydratase
Synonyms
  • MTRu-1-P dehydratase
Gene NameMDE1
Enzyme Class
Biological Properties
General FunctionInvolved in metal ion binding
Specific FunctionCatalyzes the dehydration of methylthioribulose-1- phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1- phosphate (DK-MTP-1-P)
Cellular LocationCytoplasm
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
SMPDB Reactions
5-Methylthioribulose 1-phosphate5-(methylsulfanyl)-2,3-dioxopentyl phosphate + water
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB000245-(methylsulfanyl)-2,3-dioxopentyl phosphateShow
YMDB001295-Methylthioribulose 1-phosphateShow
YMDB00890waterShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
lyase activity
binding
ion binding
cation binding
metal ion binding
carbon-oxygen lyase activity
hydro-lyase activity
Process
sulfur amino acid biosynthetic process
metabolic process
methionine biosynthetic process
L-methionine biosynthetic process
L-methionine salvage
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
sulfur amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR024C
Gene Sequence>735 bp ATGTCTTCACAAGATGTTCTGATACATTCAGATGATCCGTGCCATCCAGCAAATCTCATT TGCACGCTATGCAAGCAGTTTTTTCATAATAATTGGTGCACCGGAACTGGAGGTGGGATT TCAATAAAAGATCCTAACACGAATTATTATTATCTCGCCCCATCTGGGGTGCAGAAGGAG AAGATGATACCTGAGGATTTGTTTGTCATGGACGCTCAGACATTAGAGTATTTGCGCTCT CCCAAGCTTTACAAGCCAAGCGCATGTACTCCATTGTTCTTAGCGTGCTACCAAAAGAAA AATGCAGGTGCTATAATACATACACACTCCCAAAATGCTGTGATATGCTCCTTGCTATTT GGCGATGAGTTCAGGATTGCTAACATCGAACAAATCAAAGCAATTCCAAGCGGAAAGGTG GACCCTGTGACCAAGAAACCCATGGCGCTATCGTTTTTTGATACGCTGAAGATTCCCATC ATTGAAAACATGGCGCATGAGGACGAGTTGATCGATGACTTGCACAAGACTTTTAAAGAT TATCCAGACACATGCGCCGTAATTGTGAGGAGACATGGCATTTTTGTTTGGGGTCCGACA ATCGATAAGGCCAAAATTTTCAACGAAGCCATCGATTATTTGATGGAGCTGGCCATAAAG ATGTACCAAATGGGGATTCCTCCCGACTGTGGCATTGGCGAAGAGAAGAAGCATCTGAAG ATGGCCAGTCCGTGA
Protein Properties
Pfam Domain Function
Protein Residues244
Protein Molecular Weight27426.59961
Protein Theoretical pI6.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methylthioribulose-1-phosphate dehydratase MSSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKE KMIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLF GDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKD YPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK MASP
References
External Links
ResourceLink
Saccharomyces Genome Database MDE1
Uniprot IDP47095
Uniprot NameMTNB_YEAST
GenBank Gene IDAY692565
Genebank Protein ID51012581
General Reference
  • Zagulski, M., Babinska, B., Gromadka, R., Migdalski, A., Rytka, J., Sulicka, J., Herbert, C. J. (1995). "The sequence of 24.3 kb from chromosome X reveals five complete open reading frames, all of which correspond to new genes, and a tandem insertion of a Ty1 transposon." Yeast 11:1179-1186.8619316
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Pirkov, I., Norbeck, J., Gustafsson, L., Albers, E. (2008). "A complete inventory of all enzymes in the eukaryotic methionine salvage pathway." FEBS J 275:4111-4120.18625006