Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethylthioribulose-1-phosphate dehydratase
Synonyms
  • MTRu-1-P dehydratase
Gene NameMDE1
Enzyme Class
Biological Properties
General FunctionInvolved in metal ion binding
Specific FunctionCatalyzes the dehydration of methylthioribulose-1- phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1- phosphate (DK-MTP-1-P)
Cellular LocationCytoplasm
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
SMPDB Reactions
5-Methylthioribulose 1-phosphate5-(methylsulfanyl)-2,3-dioxopentyl phosphate + water
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB000245-(methylsulfanyl)-2,3-dioxopentyl phosphateShow
YMDB001295-Methylthioribulose 1-phosphateShow
YMDB00890waterShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
binding
ion binding
catalytic activity
cation binding
metal ion binding
carbon-oxygen lyase activity
lyase activity
hydro-lyase activity
Process
L-methionine biosynthetic process
L-methionine salvage
metabolic process
cellular metabolic process
sulfur amino acid metabolic process
cellular amino acid and derivative metabolic process
sulfur amino acid biosynthetic process
cellular amino acid metabolic process
methionine biosynthetic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR024C
Gene Sequence>735 bp ATGTCTTCACAAGATGTTCTGATACATTCAGATGATCCGTGCCATCCAGCAAATCTCATT TGCACGCTATGCAAGCAGTTTTTTCATAATAATTGGTGCACCGGAACTGGAGGTGGGATT TCAATAAAAGATCCTAACACGAATTATTATTATCTCGCCCCATCTGGGGTGCAGAAGGAG AAGATGATACCTGAGGATTTGTTTGTCATGGACGCTCAGACATTAGAGTATTTGCGCTCT CCCAAGCTTTACAAGCCAAGCGCATGTACTCCATTGTTCTTAGCGTGCTACCAAAAGAAA AATGCAGGTGCTATAATACATACACACTCCCAAAATGCTGTGATATGCTCCTTGCTATTT GGCGATGAGTTCAGGATTGCTAACATCGAACAAATCAAAGCAATTCCAAGCGGAAAGGTG GACCCTGTGACCAAGAAACCCATGGCGCTATCGTTTTTTGATACGCTGAAGATTCCCATC ATTGAAAACATGGCGCATGAGGACGAGTTGATCGATGACTTGCACAAGACTTTTAAAGAT TATCCAGACACATGCGCCGTAATTGTGAGGAGACATGGCATTTTTGTTTGGGGTCCGACA ATCGATAAGGCCAAAATTTTCAACGAAGCCATCGATTATTTGATGGAGCTGGCCATAAAG ATGTACCAAATGGGGATTCCTCCCGACTGTGGCATTGGCGAAGAGAAGAAGCATCTGAAG ATGGCCAGTCCGTGA
Protein Properties
Pfam Domain Function
Protein Residues244
Protein Molecular Weight27426.59961
Protein Theoretical pI6.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methylthioribulose-1-phosphate dehydratase MSSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKE KMIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLF GDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKD YPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK MASP
References
External Links
ResourceLink
Saccharomyces Genome Database MDE1
Uniprot IDP47095
Uniprot NameMTNB_YEAST
GenBank Gene IDAY692565
Genebank Protein ID51012581
General Reference
  • Zagulski, M., Babinska, B., Gromadka, R., Migdalski, A., Rytka, J., Sulicka, J., Herbert, C. J. (1995). "The sequence of 24.3 kb from chromosome X reveals five complete open reading frames, all of which correspond to new genes, and a tandem insertion of a Ty1 transposon." Yeast 11:1179-1186.8619316
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Pirkov, I., Norbeck, J., Gustafsson, L., Albers, E. (2008). "A complete inventory of all enzymes in the eukaryotic methionine salvage pathway." FEBS J 275:4111-4120.18625006