You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSulfite efflux pump SSU1
Synonyms
  • Sulfite sensitivity protein SSU1
Gene NameSSU1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionInvolved in efflux of free sulfite. Mutations in the SSU1 gene cause sensitivity to sulfite
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00114SulfiteShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
Not Available
Process
establishment of localization
transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 16
LocusYPL092W
Gene Sequence>1377 bp ATGGTTGCCAATTGGGTACTTGCTCTTACGAGGCAGTTTGACCCCTTCATGTTTGTGATG GTCATGGGTGTCGGCATTTCATCGAATATTCTATATAGCTTCCCATATCCTGCAAGGTGG CTAAGAATATGCTCCTACATCATGTTTGCTATCACTTGCCTTATTTTCATTGCTGTGCAG GCACTACAAATATTACATTTGATTGTCTATATTAAGGAGAAAAGCTTCAGAGAATATTTT AATGACTTTTTCAGAAATATGAAGCACAGTTTATTTTGGGGTACTTATCCCATGGGGTTA GTTACAATTATAAATTTCTTAGGAGCACTCTCGAAAGCGAACACGACGAAGAGCCCCACT AATGCCAGAAATTTGATGATATTTGTTTACGTCTTGTGGTGGTATGATCTCGCAGTCTGT CTAGTAATAGCGTGGGGTATCTCGTTTCTCATCTGGCATGACTATTACTCTTTGGAAGGG ATTGGGAATTATCCTTCATATAATATCAAAATGGCATCCGAAAACATGAAAAGTGTATTG CTACTGGATATCATTCCGCTGGTTGTCGTCGCTTCAAGTTGTGGAACATTCACAATGTCA GAAATATTCTTCCATGCGTTTAATAGAAACATTCAACTGATAACGTTGGTCATATGTGCC TTAACGTGGCTGCATGCCATTATCTTCGTCTTCATACTGATTGCGATATACTTCTGGAGT CTTTATATTAATAAGATACCACCAATGACACAGGTTTTCACCTTATTCCTGCTTTTGGGC CCGATGGGCCAAGGAAGTTTTGGAGTCTTATTGCTTACAGATAATATAAAAAAATATGCG GGCAAATATTACCCAACAGATAACATTACAAGAGAACAAGAGATATTGACTATTGCAGTT CCATGGTGTTTCAAAATTCTAGGCATGGTTTCTGCTATGGCATTGCTCGCTATGGGCTAT TTTTTCACCGTGATTTCTGTCGTTTCAATCCTGTCGTACTACAATAAAAAAGAGATTGAA AACGAGACAGGAAAAGTGAAGAGAGTTTATACCTTCCACAAAGGTTTTTGGGGGATGACT TTCCCGATGGGTACTATGTCTTTAGGAAACGAAGAGTTATATGTGCAGTATAACCAGTAC GTTCCCTTATATGCATTTAGAGTCCTAGGAACCATATACGGCGGTGTTTGCGTTTGTTGG TCAATTCTATGCCTTTTATGCACATTGCATGAGTATTCTAAAAAGATGCTGCATGCTGCC CGTAAATCTTCATTATTTTCAGAGTCAGGTACGGAAAAGACGACAGTTTCTCCGTATAAC AGCATTGAAAGCGTGGAAGAATCAAACTCGGCTCTAGATTTTACGCGTTTAGCATAA
Protein Properties
Pfam Domain Function
Protein Residues458
Protein Molecular Weight52544.69922
Protein Theoretical pI8.6
Signalling Regions
  • None
Transmembrane Regions
  • 12-32
  • 49-69
  • 90-110
  • 136-156
  • 177-197
  • 221-241
  • 253-275
  • 310-330
  • 351-371
  • 388-408
Protein Sequence>Sulfite efflux pump SSU1 MVANWVLALTRQFDPFMFMMVMGVGISSNILYSFPYPARWLRICSYIMFAIACLIFIAVQ ALQILHLIVYIKEKSFREYFNDFFRNMKHNLFWGTYPMGLVTIINFLGALSKANTTKSPT NARNLMIFVYVLWWYDLAVCLVIAWGISFLIWHDYYPLEGIGNYPSYNIKMASENMKSVL LLDIIPLVVVASSCGTFTMSEIFFHAFNRNIQLITLVICALTWLHAIIFVFILIAIYFWS LYINKIPPMTQVFTLFLLLGPMGQGSFGVLLLTDNIKKYAGKYYPTDNITREQEILTIAV PWCFKILGMVSAMALLAMGYFFTVISVVSILSYYNKKEIENETGKVKRVYTFHKGFWGMT FPMGTMSLGNEELYVQYNQYVPLYAFRVLGTIYGGVCVCWSILCLLCTLHEYSKKMLHAA RKSSLFSESGTEKTTVSPYNSIESVEESNSALDFTRLA
References
External Links
ResourceLink
Saccharomyces Genome Database SSU1
Uniprot IDP41930
Uniprot NameSSU1_YEAST
GenBank Gene IDAB002531
Genebank Protein ID1944122
General Reference
  • Avram, D., Bakalinsky, A. T. (1997). "SSU1 encodes a plasma membrane protein with a central role in a network of proteins conferring sulfite tolerance in Saccharomyces cerevisiae." J Bacteriol 179:5971-5974.9294463
  • Aa, E., Townsend, J. P., Adams, R. I., Nielsen, K. M., Taylor, J. W. (2006). "Population structure and gene evolution in Saccharomyces cerevisiae." FEMS Yeast Res 6:702-715.16879422
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Perez-Ortin, J. E., Querol, A., Puig, S., Barrio, E. (2002). "Molecular characterization of a chromosomal rearrangement involved in the adaptive evolution of yeast strains." Genome Res 12:1533-1539.12368245
  • Xu, X., Wightman, J. D., Geller, B. L., Avram, D., Bakalinsky, A. T. (1994). "Isolation and characterization of sulfite mutants of Saccharomyces cerevisiae." Curr Genet 25:488-496.8082198
  • Park, H., Bakalinsky, A. T. (2000). "SSU1 mediates sulphite efflux in Saccharomyces cerevisiae." Yeast 16:881-888.10870099
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956