You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBenzil reductase IRC24
Synonyms
  • Increased recombination centers protein 24
Gene NameIRC24
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionReduces benzil stereospecifically to (S)-benzoin. Is probably involved in a pathway contributing to genomic integrity
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00136benzilShow
YMDB00336benzoinShow
YMDB00426NADPHShow
YMDB00427NADPShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
oxidoreductase activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 9
LocusYIR036C
Gene Sequence>792 bp ATGGGCAAGGTTATTTTGATTACAGGTGCCTCCCGTGGGATTGGCCTGCAATTGGTGAAA ACTGTTATCGAAGAGGACGATGAATGCATCGTCTACGGCGTAGCAAGAACGGAAGCTGGT CTGCAGTCTTTGCAAAGAGAATACGGTGCAGACAAATTTGTCTATCGTGTCCTCGACATC ACGGACAGGTCTCGAATGGAAGCGTTGGTGGAGGAAATCCGGCAAAAGCATGGAAAACTG GACGGTATTGTCGCAAATGCGGGGATGCTAGAACCGGTGAAGTCCATCTCCCAGTCCAAC TCCGAACACGACATCAAGCAGTGGGAACGGCTGTTCGATGTGAACTTTTTCAGCATTGTC TCTTTGGTGGCACTGTGTTTACCCCTCTTGAAGAGCTCGCCATTTGTAGGCAACATTGTC TTCGTCAGCTCTGGAGCCAGTGTGAAACCATATAACGGATGGTCGGCGTACGGCTGCTCG AAAGCCGCATTAAACCACTTTGCCATGGACATTGCCAGTGAAGAGCCCAGTGATAAAGTG CGTGCCGTGTGTATTGCACCGGGCGTCGTTGACACGCAGATGCAGAAAGATATTAGGGAA ACATTGGGTCCTCAGGGCATGACACCCAAGGCTCTCGAGAGGTTTACTCAATTGTACAAG ACTTCGTCACTGCTGGACCCAAAGGTGCCTGCGGCGGTACTAGCGCAACTCGTCCTGAAA GGTATTCCCGACTCTTTGAACGGTCAATATCTCCGCTACAACGATGAGCGACTGGGGCCG GTGCAGGGCTAG
Protein Properties
Pfam Domain Function
Protein Residues263
Protein Molecular Weight28803.90039
Protein Theoretical pI6.28
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Benzil reductase IRC24 MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV SLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLK GIPDSLNGQYLRYNDERLGPVQG
References
External Links
ResourceLink
Saccharomyces Genome Database IRC24
Uniprot IDP40580
Uniprot NameBZRD_YEAST
GenBank Gene IDAB052924
Genebank Protein ID19386576
General Reference
  • Maruyama, R., Nishizawa, M., Itoi, Y., Ito, S., Inoue, M. (2002). "The enzymes with benzil reductase activity conserved from bacteria to mammals." J Biotechnol 94:157-169.11796169
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Fry, R. C., DeMott, M. S., Cosgrove, J. P., Begley, T. J., Samson, L. D., Dedon, P. C. (2006). "The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA." BMC Genomics 7:313.17163986
  • Alvaro, D., Lisby, M., Rothstein, R. (2007). "Genome-wide analysis of Rad52 foci reveals diverse mechanisms impacting recombination." PLoS Genet 3:e228.18085829