You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Synonyms
  • 5-proFAR isomerase
  • Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
Gene NameHIS6
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific Function1-(5-phosphoribosyl)-5-((5- phosphoribosylamino)methylideneamino)imidazole-4-carboxamide = 5- ((5-phospho-1-deoxyribulos-1-ylamino)methylideneamino)-1-(5- phosphoribosyl)imidazole-4-carboxamide
Cellular LocationCytoplasm
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Histidine metabolismec00340 Map00340
SMPDB Reactions
PhosphoribosylformiminoAICAR-phosphatePhosphoribulosylformimino-AICAR-P
KEGG Reactions
1-(5-phospho-D-ribosyl)-5-[(5-phospho-D-ribosylamino)methylideneamino]imidazole-4-carboxamide5-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
Metabolites
YMDB IDNameView
YMDB000925-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-D-ribosyl)imidazole-4-carboxamideShow
YMDB004171-(5-phospho-D-ribosyl)-5-[(5-phospho-D-ribosylamino)methylideneamino]imidazole-4-carboxamideShow
YMDB009835-((5-phospho-1-deoxyribulos-1-ylamino)methylideneamino)-1-(5-phosphoribosyl)imidazole-4-carboxamideShow
YMDB16238PhosphoribosylformiminoAICAR-phosphateShow
YMDB16239Phosphoribulosylformimino-AICAR-PShow
GO Classification
Component
Not Available
Function
isomerase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
catalytic activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
histidine family amino acid metabolic process
histidine metabolic process
histidine biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL020C
Gene Sequence>786 bp ATGACGAAGTTTATTGGTTGTATAGACCTGCATAATGGAGAGGTTAAACAGATTGTAGGT GGAACGTTAACGAGCAAAAAGGAGGACGTTCCAAAAACTAACTTTGTATCACAACATCCT TCTTCATATTACGCTAAACTTTACAAAGACAGAGATGTCCAAGGATGTCATGTTATTAAG TTGGGACCTAACAATGACGACGCTGCACGCGAGGCACTCCAGGAGTCACCACAATTTCTA CAAGTGGGCGGAGGAATTAATGATACGAACTGTTTGGAATGGTTAAAATGGGCCAGTAAA GTAATTGTTACGAGTTGGCTATTTACAAAAGAGGGTCATTTTCAATTAAAAAGGTTAGAA AGACTGACAGAACTATGTGGGAAAGACCGCATTGTTGTAGACTTAAGCTGTAGAAAAACC CAGGACGGTCGTTGGATTGTGGCCATGAACAAATGGCAAACTCTAACTGATCTTGAGCTT AATGCTGACACTTTCAGAGAATTGAGGAAATATACAAATGAGTTTCTAATTCACGCTGCA GACGTTGAAGGTTTGTGTGGTGGTATCGATGAATTATTGGTTTCTAAGCTTTTCGAATGG ACCAAAGATTACGATGATTTGAAAATCGTTTATGCTGGTGGGGCCAAAAGTGTTGATGAT TTGAAATTAGTAGACGAACTAAGTCACGGAAAAGTAGATTTGACATTCGGTAGTTCCTTA GATATATCTGGTGGTAACCTAGTTAAGTTTGAAGACTGCTGTAGATGGAATGAAAAGCAA GGTTAG
Protein Properties
Pfam Domain Function
Protein Residues261
Protein Molecular Weight29556.40039
Protein Theoretical pI5.69
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase MTKFIGCIDLHNGEVKQIVGGTLTSKKEDVPKTNFVSQHPSSYYAKLYKDRDVQGCHVIK LGPNNDDAAREALQESPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLE RLTELCGKDRIVVDLSCRKTQDGRWIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAA DVEGLCGGIDELLVSKLFEWTKDYDDLKIVYAGGAKSVDDLKLVDELSHGKVDLTFGSSL DIFGGNLVKFEDCCRWNEKQG
References
External Links
ResourceLink
Saccharomyces Genome Database HIS6
Uniprot IDP40545
Uniprot NameHIS4_YEAST
GenBank Gene IDAY557859
Genebank Protein ID45269609
General Reference
  • Fani, R., Tamburini, E., Mori, E., Lazcano, A., Lio, P., Barberio, C., Casalone, E., Cavalieri, D., Perito, B., Polsinelli, M. (1997). "Paralogous histidine biosynthetic genes: evolutionary analysis of the Saccharomyces cerevisiae HIS6 and HIS7 genes." Gene 197:9-17.9332345
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106