Identification
NameCytochrome b5
SynonymsNot Available
Gene NameCYB5
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in electron carrier activity
Specific FunctionMembrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. It plays a role in fatty-acid desaturation and is also involved in several steps of the sterol biosynthesis pathway, particularly in the 4- demethylation of the 4,4'-dimethyl zymosterol
Cellular LocationEndoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
ion binding
cation binding
metal ion binding
transition metal ion binding
heme binding
iron ion binding
binding
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>363 bp ATGCCTAAAGTTTACAGTTACCAAGAAGTTGCCGAACACAATGGCCCAGAAAATTTCTGG ATTATCATCGATGACAAAGTTTACGATGTTTCTCAATTCAAAGATGAACATCCAGGTGGT GATGAAATTATAATGGATTTGGGTGGACAAGATGCTACAGAAAGCTTTGTCGATATCGGT CATTCTGACGAAGCATTGAGACTACTGAAAGGTTTATACATTGGTGACGTTGACAAGACC AGTGAGCGCGTTTCTGTGGAAAAGGTATCTACCTCTGAAAACCAAAGTAAAGGTAGTGGT ACATTGGTTGTCATATTGGCCATTTTAATGCTAGGTGTTGCTTATTATTTGTTGAACGAA TAA
Protein Properties
Pfam Domain Function
Protein Residues120
Protein Molecular Weight13296.7998
Protein Theoretical pI4.1
Signalling Regions
  • None
Transmembrane Regions
  • 98-118
Protein Sequence>Cytochrome b5 MPKVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG HSDEALRLLKGLYIGDVDKTSERVSVEKVSTSENQSKGSGTLVVILAILMLGVAYYLLNE
References
External Links
ResourceLink
Saccharomyces Genome Database CYB5
Uniprot IDP40312
Uniprot NameCYB5_YEAST
GenBank Gene IDAY693106
Genebank Protein ID51013663
General Reference
  • Truan, G., Epinat, J. C., Rougeulle, C., Cullin, C., Pompon, D. (1994). "Cloning and characterization of a yeast cytochrome b5-encoding gene which suppresses ketoconazole hypersensitivity in a NADPH-P-450 reductase-deficient strain." Gene 142:123-127.8181746
  • De Antoni, A., D'Angelo, M., Dal Pero, F., Sartorello, F., Pandolfo, D., Pallavicini, A., Lanfranchi, G., Valle, G. (1997). "The DNA sequence of cosmid 14-13b from chromosome XIV of Saccharomyces cerevisiae reveals an unusually high number of overlapping open reading frames." Yeast 13:261-266.9090055
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106