You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome c oxidase assembly protein COX15
SynonymsNot Available
Gene NameCOX15
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in protein complex assembly
Specific FunctionRequired for the assembly of yeast cytochrome oxidase. Involved in the biosynthesis of heme A and the initial step in this pathway, the hydroxylation of heme O, is thought to be catalyzed by a three-component mono-oxygenase consisting of COX15, ferredoxin and ferredoxin reductase
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00882Heme AShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
cell part
membrane
Function
Not Available
Process
macromolecular complex assembly
protein complex assembly
cellular component organization or biogenesis
cellular component organization
cellular component assembly
Gene Properties
Chromosome Locationchromosome 5
LocusYER141W
Gene Sequence>1461 bp ATGCTTTTCAGAAACATAGAAGTGGGCAGGCAGGCAGCTAAGCTATTAACGAGAACCTCG AGTCGTTTGGCCTGGCAAAGTATTGGGGCCTCAAGGAATATTTCTACCATCAGACAACAA ATCAGAAAGACTCAACTATATAATTTTAAGAAAACTGTGAGCATCCGTCCATTTTCTCTC TCCTCCCCTGTTTTTAAACCACATGTTGCTTCAGAATCAAACCCTATAGAATCACGTTTG AAGACCTCGAAGAATGTTGCTTACTGGTTAATAGGTACATCCGGTTTGGTATTTGGTATT GTTGTTCTTGGTGGGTTGACTAGACTAACAGAATCGGGGCTGAGTATTACCGAATGGAAA CCTGTCACAGGTACTTTGCCCCCTATGAACCAGAAGGAATGGGAAGAAGAATTTATCAAG TATAAGGAATCACCAGAATTTAAATTGTTGAATTCTCACATTGATTTAGACGAGTTCAAG TTTATATTTTTTATGGAGTGGATTCATAGATTGTGGGGTCGTGCTATCGGCGCTGTTTTT ATATTACCTGCAGTTTATTTCGCTGTATCTAAAAAAACTTCAGGCCATGTCAATAAGAGG TTGTTTGGTCTCGCAGGTTTATTAGGATTACAAGGATTTGTTGGTTGGTGGATGGTGAAG TCTGGTCTTGATCAAGAGCAACTAGACGCAAGAAAATCAAAGCCTACCGTTTCTCAATAT AGACTTACTACGCATTTGGGTACCGCCTTCTTTTTATACATGGGTATGCTCTGGACTGGT TTGGAAATATTGAGAGAATGTAAATGGATTAAGAACCCTGTTCAAGCCATTAGTCTCTTC AAAAAATTAGATAATCCCGCAATTGGCCCAATGAGAAAGATTTCTTTAGCTTTGTTAGCG GTGTCTTTCCTTACCGCTATGAGTGGCGGTATGGTTGCCGGTTTGGATGCTGGTTGGGTC TATAACACCTGGCCAAAAATGGGTGAACGATGGTTCCCTAGTTCTCGTGAATTAATGGAC GAAAACTTCTGTAGAAGAGAGGACAAGAAAGATCTGTGGTGGAGGAATTTGCTAGAAAAC CCGGTTACAGTTCAGTTGGTCCATAGGACATGTGCGTACGTTGCGTTTACATCAGTACTA GCTGCTCATATGTACGCTATCAAAAAGAAGGCCGTAATTCCAAGGAACGCGATGACCTCT TTGCATGTTATGATGGGCGTCGTTACTTTACAAGCAACACTTGGTATTTTAACTATATTG TACCTAGTCCCAATATCGTTAGCTTCTATCCATCAAGCTGGTGCTTTGGCGTTGCTAACA AGTTCTTTGGTGTTTGCCTCTCAATTAAGGAAGCCAAGAGCTCCGATGAGAAACGTAATC ATTACCTTGCCACATTCAAGCAAAGTAACTAGCGGTAAAATTTTAAGTGAAGCGTCGAAG TTAGCCTCGAAACCATTATAA
Protein Properties
Pfam Domain Function
Protein Residues486
Protein Molecular Weight54657.89844
Protein Theoretical pI10.83
Signalling Regions
  • None
Transmembrane Regions
  • 86-106
  • 171-191
  • 201-221
  • 244-264
  • 294-314
  • 403-423
  • 425-445
Protein Sequence>Cytochrome c oxidase assembly protein COX15 MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFKKTVSIRPFSL SSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGIVVLGGLTRLTESGLSITEWK PVTGTLPPMNQKEWEEEFIKYKESPEFKLLNSHIDLDEFKFIFFMEWIHRLWGRAIGAVF ILPAVYFAVSKKTSGHVNKRLFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQY RLTTHLGTAFFLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKKDLWWRNLLEN PVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTSLHVMMGVVTLQATLGILTIL YLVPISLASIHQAGALALLTSSLVFASQLRKPRAPMRNVIITLPHSSKVTSGKILSEASK LASKPL
References
External Links
ResourceLink
Saccharomyces Genome Database COX15
Uniprot IDP40086
Uniprot NameCOX15_YEAST
GenBank Gene IDL38643
Genebank Protein ID603947
General Reference
  • Glerum, D. M., Muroff, I., Jin, C., Tzagoloff, A. (1997). "COX15 codes for a mitochondrial protein essential for the assembly of yeast cytochrome oxidase." J Biol Chem 272:19088-19094.9228094
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Barros, M. H., Carlson, C. G., Glerum, D. M., Tzagoloff, A. (2001). "Involvement of mitochondrial ferredoxin and Cox15p in hydroxylation of heme O." FEBS Lett 492:133-138.11248251