You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeptide methionine sulfoxide reductase
Synonyms
  • Peptide-methionine (S)-S-oxide reductase
  • Peptide Met(O) reductase
  • Protein-methionine-S-oxide reductase
Gene NameMXR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
Specific FunctionHas an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. Also able to reduce dimethyl sulfoxide (DMSO) as well, with DMS as the product
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00035L-methionine (R)-S-oxideShow
YMDB00318L-MethionineShow
YMDB00331Methionine sulfoxideShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
oxidoreductase activity, acting on a sulfur group of donors
oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
catalytic activity
Process
macromolecule metabolic process
oxidation reduction
protein metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER042W
Gene Sequence>555 bp ATGTCGTCGCTTATTTCAAAAACCATTAAGTATGATCCAGCCAAGGATAAATTAATCACA TTAGCATGTGGATGTTTTTGGGGTACAGAACATATGTATAGGAAGTATTTGAATGACCGT ATAGTGGATTGTAAAGTAGGTTACGCTAATGGAGAAGAGTCTAAAAAGGATAGCCCCTCT AGTGTCTCTTATAAGAGAGTTTGTGGTGGTGACACAGATTTTGCGGAGGTTTTACAAGTA TCCTATAATCCCAAAGTGATAACTTTGAGAGAATTAACTGATTTCTTTTTTAGAATCCAT GATCCTACTACATCTAATTCACAAGGACCTGATAAAGGTACACAGTATCGCAGTGGATTG TTCGCTCATTCAGATGCTGATTTAAAAGAATTAGCCAAAATAAAGGAAGAATGGCAACCA AAATGGGGTAATAAGATTGCCACAGTTATTGAACCAATCAAGAACTTTTACGATGCTGAA GAATACCACCAGTTATATTTAGATAAGAATCCACAGGGATATGCATGCCCTACTCATTAT CTGAGAGAAATGTAG
Protein Properties
Pfam Domain Function
Protein Residues184
Protein Molecular Weight21140.69922
Protein Theoretical pI7.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peptide methionine sulfoxide reductase MSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYLNDRIVDCKVGYANGEESKKDSPS SVSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGL FAHSDADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAEEYHQLYLDKNPQGYACPTHY LREM
References
External Links
ResourceLink
Saccharomyces Genome Database MXR1
Uniprot IDP40029
Uniprot NameMSRA_YEAST
GenBank Gene IDAY692798
Genebank Protein ID51013047
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Hansen, J. (1999). "Inactivation of MXR1 abolishes formation of dimethyl sulfide from dimethyl sulfoxide in Saccharomyces cerevisiae." Appl Environ Microbiol 65:3915-3919.10473395
  • Moskovitz, J., Poston, J. M., Berlett, B. S., Nosworthy, N. J., Szczepanowski, R., Stadtman, E. R. (2000). "Identification and characterization of a putative active site for peptide methionine sulfoxide reductase (MsrA) and its substrate stereospecificity." J Biol Chem 275:14167-14172.10799493
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956