Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative 2-hydroxyacyl-CoA lyase
SynonymsNot Available
Gene NameNot Available
Enzyme ClassNot Available
Biological Properties
General Functionthiamine pyrophosphate binding
Specific FunctionCatalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Cellular LocationNot Available
SMPDB Pathways
isoleucine biosynthesisPW002476 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
cytoplasm
carboxy-lyase activity
magnesium ion binding
thiamine pyrophosphate binding
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1683 bp ATGACCACGACCGCTACCCAACACTTCGCTCAACTTTTACAAAAATATGGCATCGACACA GTCTTTGGAATTGTGGGCATCCCTATTGTCCAACTAGCGGATACGATGGTTGCCAACGGT ATCAAATTCATTCCATGCAGGAACGAACAGGCTGCCTCATATGCAGCCTCTGCTTATGGT TATATTAGTGATAAGCCCGGCGTGTTACTTATTGTCGGGGGCCCCGGTTTAATCCACGCA CTGGCTGGTATATACAACTCAATGAGTAATAGGTGGCCTCTTCTAGTAATTGCAGGGAGT TCTTCTCAAAGTGATATACATAAAGGCGGGTTTCAAGAGTTGGATCAAGTTAGTCTTTTG TCCCCATTTTTGAAGTTTACCGGAAAGTTAACCCCTGACAATATTGACATGATTACTCAG AAGGCTTTGAATTACTGTATACAAGGCACTGCAGGGGTTTCTTACATAGACGTCCCTGCA GATTTTATTGAGTATGAAAAACCCTTAGAAGGAAACGACCGTACAGGAAATGAATTACCG ATGATATTAACTCCAAACATATGTGGCCCTGATCCGTCGAAGATCAAAAAAGTCGTACAG CTTATTTTGCAACATAAAAATAAAAATATTCTGATTGTTATTGGAAAGGGTGCGGTAAAA AACTCACACGAAATCCGCAGACTAGTAAATACGTTCAATCTACCATTTTTACCCACCCCA ATGGCTAAGGGAATTGTCCCAGACTCTTCTCCACTGAACGTTTCATCTGCAAGATCTCAA GCATTGAAAATAGCGGATATTGTTCTTGTTCTCGGGGCAAGATTAAACTGGATATTGCAT TTTGGTACTTCACCCAAATGGAACTCAGAATCCATATTCATCCAGTTCGATTCCAATCCC GAAACCTTGGGGGATAACAATGTCTCACCTGGTGCTGACCTTTCCATATGGGGAGATATA GGCTTGAGCGTAACCGCTTTAGTTGAGGAATTGACTCGCCAAGATTCCTGCTGGAAGTAT AGTGGTGTTAAGCAAGAAATACGAGAGAAAATTCAACTGAATCAAACTCGTCTATTGAGG AAAGAGAAGACTAGAGGGGCACAATTGAATTACAACCAGGTTTATGGAACATTGAGGCCT CTTATCGATGATTACAGGACAATACTTGTGACGGAGGGAGCAAATACTATGGATATTGCG CGTATTTCATTCCCTACAGACGCTCCAAGGCGCCGTTTAGACGCAGGGACCAACGCGACT ATGGGGATTGGGCTCGGATATGCTCTTGCATGCAAGGCATCTCATCCGGAACTCGATGTG GTGCTGATTCAGGGTGATTCCGCATTTGGATTCTCTGCCATGGAAATTGAAACGGCAGTA AGGTGTCAGCTGGCATTGGTCATCGTTGTGATGAACAATAGCGGTATTTACCATGGAGAA AAGGATATAGAGGGTGATTTACCTCCAACGGCACTAAGCAAGAACTGCCGTTACGATCTC GTAGGCAAAGGACTGGGTGCCAATGATTTTTTTGTCAACACAATAAGCGAACTGAGCAGA TGCTTCCAACAAGCCGTGCAGCTTTCTCGGACTAAAAGAGAAACAAGTGTCATCAACGTT ATCATTGAGCCTGGCGAACAAAAGCAAATTGCCTTTGCCTGGCAGAATAAACCGCGTTTA TAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues560
Protein Molecular Weight61287.885
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Putative 2-hydroxyacyl-CoA lyase MTTTATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMVANGIKFIPCRNEQAASYAASAYG YISDKPGVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSLL SPFLKFTGKLTPDNIDMITQKALNYCIQGTAGVSYIDVPADFIEYEKPLEGNDRTGNELP MILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLVNTFNLPFLPTP MAKGIVPDSSPLNVSSARSQALKIADIVLVLGARLNWILHFGTSPKWNSESIFIQFDSNP ETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYSGVKQEIREKIQLNQTRLLR KEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIARISFPTDAPRRRLDAGTNAT MGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAVRCQLALVIVVMNNSGIYHGE KDIEGDLPPTALSKNCRYDLVGKGLGANDFFVNTISELSRCFQQAVQLSRTKRETSVINV IIEPGEQKQIAFAWQNKPRL
References
External Links
ResourceLink
Uniprot IDP39994
General ReferenceNot Available