You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable diacetyl reductase [(R)-acetoin forming] 2
SynonymsNot Available
Gene NameBDH2
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionCatalyzes the irreversible reduction of 2,3-butanediol to (S)-acetoin in the presence of NADH (Potential)
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Butanoate metabolismec00650 Map00650
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00344AcetoinShow
YMDB00367DiacetylShow
YMDB00410(R)-AcetoinShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
oxidoreductase activity
zinc ion binding
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 1
LocusYAL061W
Gene Sequence>1254 bp ATGAGAGCCTTAGCGTATTTCGGTAAAGGTAACATCAGATTCACCAACCATTTAAAGGAG CCACATATTGTGGCGCCCGATGAGCTTGTGATTGATATCGAATGGTGTGGTATTTGCGGT ACGGACCTGCATGAGTACACAGATGGTCCTATCTTTTTCCCAGAAGATGGACACACACAT GAGATTAGTCATAACCCATTGCCACAGGCGATGGGCCACGAAATGGCTGGTACCGTTTTG GAGGTGGGCCCTGGTGTGAAAAACTTGAAAGTGGGAGACAAGGTAGTTGTCGAGCCCACA GGTACATGCAGAGACCGGTATCGTTGGCCCCTGTCGCCAAACGTTGACAAGGAATGGTGC GCTGCTTGCAAAAAGGGCTACTATAACATTTGTTCATATTTGGGGCTTTGTGGTGCGGGT GTGCAGAGCGGTGGATTTGCAGAACGTGTTGTGATGAACGAATCTCACTGCTACAAAGTA CCGGACTTCGTGCCCTTAGACGTTGCAGCTTTGATTCAACCGTTGGCTGTGTGCTGGCAT GCAATTAGAGTCTGCGAGTTCAAAGCAGGCTCTACGGCTTTGATCATTGGTGCTGGCCCC ATCGGACTGGGCACGATACTGGCGTTGAACGCTGCAGGTTGCAAGGACATCGTCGTTTCA GAGCCTGCCAAGGTAAGAAGAGAACTGGCTGAAAAAATGGGTGCCAGGGTTTACGACCCA ACTGCGCACGCTGCCAAGGAGAGCATTGATTATCTGAGGTCGATTGCTGATGGTGGAGAC GGCTTCGATTACACATTTGATTGCTCCGGGTTGGAAGTCACATTGAATGCTGCTATTCAG TGTCTCACTTTCAGAGGCACCGCAGTGAACTTGGCCATGTGGGGCCATCACAAGATACAG TTTTCTCCGATGGACATCACATTGCATGAAAGAAAGTACACAGGGTCCATGTGCTACACA CACCACGATTTTGAGGCAGTAATAGAAGCTTTGGAAGAAGGCAGGATTGACATTGATAGA GCAAGACATATGATAACGGGCAGAGTCAACATTGAGGACGGCCTTGATGGCGCCATCATG AAGCTGATAAACGAGAAGGAGTCTACAATCAAGATTATTCTGACTCCAAACAATCACGGA GAGTTGAACAGGGAAGCCGATAATGAGAAGAAAGAAATTTCCGAGCTGAGCAGTCGGAAA GATCAAGAAAGACTACGAGAATCAATAAACGAGGCTAAACTGCGTCACACATGA
Protein Properties
Pfam Domain Function
Protein Residues417
Protein Molecular Weight46098.19922
Protein Theoretical pI6.03
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable diacetyl reductase [(R)-acetoin forming] 2 MRALAYFGKGNIRFTNHLKEPHIVAPDELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTH EISHNPLPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWC AACKKGYYNICSYLGLCGAGVQSGGFAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDP TAHAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQCLTFRGTAVNLAMWGHHKIQ FSPMDITLHERKYTGSMCYTHHDFEAVIEALEEGRIDIDRARHMITGRVNIEDGLDGAIM KLINEKESTIKIILTPNNHGELNREADNEKKEISELSSRKDQERLRESINEAKLRHT
References
External Links
ResourceLink
Saccharomyces Genome Database BDH2
Uniprot IDP39713
Uniprot NameBDH2_YEAST
GenBank Gene IDAY692730
Genebank Protein ID51012911
General Reference
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • do Valle Matta, M. A., Jonniaux, J. L., Balzi, E., Goffeau, A., van den Hazel, B. (2001). "Novel target genes of the yeast regulator Pdr1p: a contribution of the TPO1 gene in resistance to quinidine and other drugs." Gene 272:111-119.11470516
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kaniak, A., Xue, Z., Macool, D., Kim, J. H., Johnston, M. (2004). "Regulatory network connecting two glucose signal transduction pathways in Saccharomyces cerevisiae." Eukaryot Cell 3:221-231.14871952