You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHistone-lysine N-methyltransferase, H3 lysine-4 specific
Synonyms
  • COMPASS component SET1
  • Lysine N-methyltransferase 2
  • SET domain-containing protein 1
Gene NameSET1
Enzyme Class
Biological Properties
General FunctionInvolved in histone-lysine N-methyltransferase activity
Specific FunctionCatalytic component of the COMPASS (Set1C) complex that specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation
Cellular LocationNucleus (Probable). Chromosome (Probable)
SMPDB PathwaysNot Available
KEGG Pathways
Lysine degradationec00310 Map00310
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00438S-Adenosyl-L-methionineShow
GO Classification
Component
chromatin remodeling complex
Set1C/COMPASS complex
macromolecular complex
protein complex
Function
protein-lysine N-methyltransferase activity
catalytic activity
histone-lysine N-methyltransferase activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
binding
protein binding
protein methyltransferase activity
Process
cellular process
cellular component organization at cellular level
organelle organization
chromosome organization
chromatin organization
chromatin modification
Gene Properties
Chromosome Locationchromosome 8
LocusYHR119W
Gene Sequence>3243 bp ATGACGACGAAGCCACAAAATAGTAAGCAGGGTTTAGCCGAAGGAGAGATGGATGTGAGT TCACTTTTCAAGAGAACGGAAGTTATTGGGCGAGGGAAATTTGGTGTGGTTTATAAGGGC TATAACGTGAAGACTGGACGAGTGTATGCTATCAAAGTCTTAAATTTAGATTCTGATTCT GACGAGGTGGAGGATGTGCAGCGAGAAATTCAGTTTTTGGCCTCCTTGAAACAGATTTCC AATATCACGCGGTATTATGGGTCGTATTTGAAAGACACAAGCCTTTGGATCATAATGGAA CACTGCGCTGGTGGTTCACTGCGTTCGTTGTTAAGGCCAGGCAAAATCGATGAAAAGTAC ATTGGGGTTATTATGAGAGAACTGCTTGTAGCATTAAAATGCATTCATAAAGATAACGTC ATTCATCGAGATATCAAAGCAGCAAACGTTCTGATCACTAACGAAGGTAATGTTAAACTA TGCGATTTTGGTGTCGCTGCACAAGTAAACCAAACTTCTTTACGACGTCAAACTATGGCT GGGACCCCCTACTGGATGGCTCCAGAAGTGATCATGGAAGGCGTTTATTACGACACTAAA GTAGATATATGGTCTTTAGGTATTACAACGTACGAGATTGCCACCGGAAATCCGCCATAC TGCGATGTGGAGGCCCTAAGGGCAATGCAACTAATCATCAAATCGAAACCACCGAGGCTT GAGGACAGATCATACAGTACATCTTTGAAAGAATTTATTGCGCTTTGTCTTGATGAGGAT CCAAAGGAGAGATTGTCAGCAGACGATCTTTTAAAATCAAAATTTATCAGGGCCCACAAG GCGACGCCAACGTCCATTTTGAAAGAACTAATATCACGATATCTACTATTTAGGGACAAG AATAAAAACAAATATAAAATAGAGGGCAGTATACCGGAAAATGAGCCATCAAAACCCAGT GAAGCTCCAAAACCATCACAAAATGGCGGGGGTGATGAAGCACAAAAGTCAATAGCATCA AATGATAATGAAATTAAGAGAGTGAACGAAGGCGATGTGGAAATGAAATGGGATTTTGAT TCATTGAGTTCGTCGGATTATATTATTGAAAATAATATCAACCTCGATGCTTTGGCTGAG GACAACAACGAGTGGGCTACTGCCCAACATGACCTGTTCAACTATGCATACCCTGACGAA GATTCTTATTACTTTGACCCTACAAGTCATAATACTAGACCCTTTGTTTATCAAGGGACA ACGATAGGAAAGGGCTATCCTGGTACAATAGCTCAAAATTCTACTTTGAATGCACCAGTA ACAAATAACTATACGAACTCAAAATACCCTTCCAAAATGGTAGCTGGAACTACAAACACC TCTGGAACACATACGGCCGGTCCAATGACATCATCTAAGAGGCTGGAAAGTAAGGCTCCA AAACAATTACTTGAACTTTTTGAAGACAATGAAATTATTACTGCTGAAAATGATGTCAAT ACAGAAGCTCCTAAAATAAGCAAATCCATTTCATCTCTAAATGCTGGTAATAGTTCACGA GATGATTTCATTCCCTCAATATCCAACGAGGTCAACGGAAATATCAATAATAATAAAATG CGACCACACCTTCCACCTTTATCCAGTGGGAACAATTATTATAGCCAGAGTACACCTGCT TTGCCGCTACTCCAAACAAAATTTAACAAGACGTCAAAGGGCCCTCCAACAAGTGGATTA ACTACTGCTCCAACGTCTATTGAAATAGAAATTCCTGAAGAACTACCGAATAGTGCTCTA CCAACGCCTGCGAGCGCAGATCCGGTTTTAATACCAAGCACAAAGGCCAGGTCATCTACA GTGACGGCTGGCACTCCTTCGTCATCTAGCTCAATACAATATAAATCACCTTCAAACGTG CCCAGGCGGTTGACAGTCAGTAACAATAGGCCAGAACATTGCCCAAGCACCATAACAAAT CAAAAATTGGGGTCCGCAGTTGCTTCTAATTCCGGAATCAGCTCCACTCCGAACAACAGT AATAACTATAACAACAACACTGATAGTGAGAACTCAAGAGGAAGCAGCGGTAGTAACACT GCAAATAGCACACAAATGGGCATAACCAATCCAGGTAATGTAACAAAGTTATCTACTCAT AAGGCTTCTTCACCCTCAAGGCCACTATTTGGAGTTGGAACTTCTCCCAATAGAAAGCCT GCCGGTTCCCCAACCCAAAACATTGGTCATAATTCTACTCACACGAACCTCGCGCCTCCT CCTACGATGAAACCAATGGCCAATAGCAAAGATAACAAGGACATTCTCTTGCAACCTCTG AACAGCATACCTAGTTCTTCTACACTTAACACTATTAGTGGTAATAGCAGCAATAATTTA ACCTCATCAAACTACTTTTCCAACGAAAAGGAAGGCTCAAGGGTCAATGGTGACTTTAAA CGCAACAACCCAAACTTAAAACTACAAATGCCACTACCTACACCTGTTGTGAGAAATAAA CTTCTTGATCCAAATACAGCAACCTCACAGAATAACAATGGCATGCCGGGGAGCGCTGGC ATATCCACGAACGAAAATATTAATCAATTTGGATTTAACACAAGCAGTGCGTCCAACATC CCTGTCTCAATGACTCCAATTAGTGAGAAACACATTGATTTTGGGGGCAAGATCAAGAGA AGTCAAAGCATTTCTAACAGGAAGAACTCTTCTGCCTCGGAACACCCATTGAATATTCTT GGCTCATCTGTTTCCGGCAATGTTTCCGGTATCGGTAACAACAATGTTGGCTCTAACAAC AACAGCGGCCCTAATAACAGTGTTCCTCTTTCTGCTAATACAGGAAACACTACTATCAAA GCCAATTCTACGACTATCGCAACTTCAAGTTCTGCCGCGGCATCAACGACTGCACCAATT TCACAACAGACTATTCCATCCGGAACACAATTCAATCATATTCTGAGTTCCGCCGCAACA GCTGCAAACTCGGTTAATTCTTTAGGCTTTGGCATGTGTCCTCCTCCACAGAGTTTACAA ATGGAAATGTTCTTGGACTTAGAATCGTTTCTGCCAGGAAAACAGAGGCGGGTAGACAGG AAACCCCAGGTTCTGAAAGAACTGGAAAATCTTTTACAAATGTTCGAAGAAGGTTTGCCC TGCATTGAACACGCTTTAAAGGAACAACTTATTTCAACGCCTATCAAGGATAATGAGCAT TAA
Protein Properties
Pfam Domain Function
Protein Residues1080
Protein Molecular Weight123911.0
Protein Theoretical pI9.36
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Histone-lysine N-methyltransferase, H3 lysine-4 specific MSNYYRRAHASSGSYRQPQEQPQYSRSGHYQYSNGHSHQQYSSQYNQRRRYNHNDGTRRR YNDDRPHSSNNASTRQYYATNNSQSGPYVNKKSDISSRRGMSQSRYSNSNVHNTLASSSG SLPTESALLLQQRPPSVLRYNTDNLKSKFHYFDPIKGEFFNKDKMLSWKATDKEFSETGY YVVKELQDGQFKFKIKHRHPEIKASDPRNENGIMTSGKVATHRKCRNSLILLPRISYDRY SLGPPPSCEIVVYPAQDSTTTNIQDISIKNYFKKYGEISHFEAFNDPNSALPLHVYLIKY ASSDGKINDAAKAAFSAVRKHESSGCFIMGFKFEVILNKHSILNNIISKFVEINVKKLQK LQENLKKAKEKEAENEKAKELQGKDITLPKEPKVDTLSHSSGSEKRIPYDLLGVVNNRPV LHVSKIFVAKHRFCVEDFKYKLRGYRCAKFIDHPTGIYIIFNDIAHAQTCSNAESGNLTI MSRSRRIPILIKFHLILPRFQNRTRFNKSSSSSNSTNVPIKYESKEEFIEATAKQILKDL EKTLHVDIKKRLIGPTVFDALDHANFPELLAKRELKEKEKRQQIASKIAEDELKRKEEAK RDFDLFGLYGGYAKSNKRNLKRHNSLALDHTSLKRKKLSNGIKPMAHLLNEETDSKETTP LNDEGITRVSKEHDEEDENMTSSSSEEEEEEAPDKKFKSESEPTTPESDHLHGIKPLVPD QNGSSDVLDASSMYKPTATEIPEPVYPPEEYDLKYSQTLSSMDLQNAIKDEEDMLILKQL LSTYTPTVTPETSAALEYKIWQSRRKVLEEEKASDWQIELNGTLFDSELQPGSSFKAEGF RKIADKLKINYLPHRRRVHQPLNTVNIHNERNEYTPELCQREESSNKEPSDSVPQEVSSS RDNRASNRRFQQDIEAQKAAIGTESELLSLNQLNKRKKPVMFARSAIHNWGLYALDSIAA KEMIIEYVGERIRQPVAEMREKRYLKNGIGSSYLFRVDENTVIDATKKGGIARFINHCCD PNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYKFEREKDDEERLPCLCGAPNCKGFLN
References
External Links
ResourceLink
Saccharomyces Genome Database SET1
Uniprot IDP38827
Uniprot NameSET1_YEAST
GenBank Gene IDU00059
Genebank Protein ID529127
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Nislow, C., Ray, E., Pillus, L. (1997). "SET1, a yeast member of the trithorax family, functions in transcriptional silencing and diverse cellular processes." Mol Biol Cell 8:2421-2436.9398665
  • Corda, Y., Schramke, V., Longhese, M. P., Smokvina, T., Paciotti, V., Brevet, V., Gilson, E., Geli, V. (1999). "Interaction between Set1p and checkpoint protein Mec3p in DNA repair and telomere functions." Nat Genet 21:204-208.9988274
  • Roguev, A., Schaft, D., Shevchenko, A., Pijnappel, W. W., Wilm, M., Aasland, R., Stewart, A. F. (2001). "The Saccharomyces cerevisiae Set1 complex includes an Ash2 homologue and methylates histone 3 lysine 4." EMBO J 20:7137-7148.11742990
  • Briggs, S. D., Bryk, M., Strahl, B. D., Cheung, W. L., Davie, J. K., Dent, S. Y., Winston, F., Allis, C. D. (2001). "Histone H3 lysine 4 methylation is mediated by Set1 and required for cell growth and rDNA silencing in Saccharomyces cerevisiae." Genes Dev 15:3286-3295.11751634
  • Miller, T., Krogan, N. J., Dover, J., Erdjument-Bromage, H., Tempst, P., Johnston, M., Greenblatt, J. F., Shilatifard, A. (2001). "COMPASS: a complex of proteins associated with a trithorax-related SET domain protein." Proc Natl Acad Sci U S A 98:12902-12907.11687631
  • Bryk, M., Briggs, S. D., Strahl, B. D., Curcio, M. J., Allis, C. D., Winston, F. (2002). "Evidence that Set1, a factor required for methylation of histone H3, regulates rDNA silencing in S. cerevisiae by a Sir2-independent mechanism." Curr Biol 12:165-170.11818070
  • Krogan, N. J., Dover, J., Khorrami, S., Greenblatt, J. F., Schneider, J., Johnston, M., Shilatifard, A. (2002). "COMPASS, a histone H3 (Lysine 4) methyltransferase required for telomeric silencing of gene expression." J Biol Chem 277:10753-10755.11805083
  • Santos-Rosa, H., Schneider, R., Bannister, A. J., Sherriff, J., Bernstein, B. E., Emre, N. C., Schreiber, S. L., Mellor, J., Kouzarides, T. (2002). "Active genes are tri-methylated at K4 of histone H3." Nature 419:407-411.12353038
  • Nagy, P. L., Griesenbeck, J., Kornberg, R. D., Cleary, M. L. (2002). "A trithorax-group complex purified from Saccharomyces cerevisiae is required for methylation of histone H3." Proc Natl Acad Sci U S A 99:90-94.11752412
  • Bernstein, B. E., Humphrey, E. L., Erlich, R. L., Schneider, R., Bouman, P., Liu, J. S., Kouzarides, T., Schreiber, S. L. (2002). "Methylation of histone H3 Lys 4 in coding regions of active genes." Proc Natl Acad Sci U S A 99:8695-8700.12060701
  • Santos-Rosa, H., Schneider, R., Bernstein, B. E., Karabetsou, N., Morillon, A., Weise, C., Schreiber, S. L., Mellor, J., Kouzarides, T. (2003). "Methylation of histone H3 K4 mediates association of the Isw1p ATPase with chromatin." Mol Cell 12:1325-1332.14636589
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Boa, S., Coert, C., Patterton, H. G. (2003). "Saccharomyces cerevisiae Set1p is a methyltransferase specific for lysine 4 of histone H3 and is required for efficient gene expression." Yeast 20:827-835.12845608
  • Morillon, A., Karabetsou, N., Nair, A., Mellor, J. (2005). "Dynamic lysine methylation on histone H3 defines the regulatory phase of gene transcription." Mol Cell 18:723-734.15949446
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956