Identification |
---|
Name | Putative pterin-4-alpha-carbinolamine dehydratase |
---|
Synonyms | - PHS
- 4-alpha-hydroxy-tetrahydropterin dehydratase
- Pterin carbinolamine dehydratase
- PCD
|
---|
Gene Name | Not Available |
---|
Enzyme Class | |
---|
Biological Properties |
---|
General Function | Involved in 4-alpha-hydroxytetrahydrobiopterin dehydratase activity |
---|
Specific Function | (6R)-6-(L-erythro-1,2-dihydroxypropyl)- 5,6,7,8-tetrahydro-4a-hydroxypterin = (6R)-6-(L-erythro-1,2- dihydroxypropyl)-7,8-dihydro-6H-pterin + H(2)O |
---|
Cellular Location | Not Available |
---|
SMPDB Pathways | Not Available |
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | YMDB ID | Name | View |
---|
YMDB00030 | Dihydrobiopterin | Show | YMDB00984 | (6R)-6-(l-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4a-hydroxypterin | Show |
|
---|
GO Classification | Component |
---|
Not Available | Function |
---|
lyase activity | carbon-oxygen lyase activity | hydro-lyase activity | 4-alpha-hydroxytetrahydrobiopterin dehydratase activity | catalytic activity | Process |
---|
metabolic process | biosynthetic process | cellular biosynthetic process | heterocycle biosynthetic process | pteridine and derivative biosynthetic process | tetrahydrobiopterin biosynthetic process |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | YHL018W |
---|
Gene Sequence | >363 bp
ATGCACAACAAGATTGTTAGAATCGCGTCCAGTGCACTCACAGGGGGCAAACTACTCGAG
AAGCTAAAACCCTTGACCCGTTGGGAAGTTCAATGGGACCCTAATAAGACCAAATGTTTG
GGAATAACAAGAGAGGTAACATTCAAGGACTACGAAACCACATGGGCCTTTTTGACTCGT
GTATCGATGAGATCTCATCTATGGGGCCACCATCCCCTGATTCACACAAGTTACACCTGG
GTCAAGCTGGAACTTCATACGCATGACATAGACCCGAAAGACGGGGCTCACAGCCAGCTT
AGCGATATAGACGTCCGGATGGCCAAGAGAATAGATTCCTACATCGATGAGATGACAACT
TGA |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 120 |
---|
Protein Molecular Weight | 14026.0 |
---|
Protein Theoretical pI | 9.09 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >Putative pterin-4-alpha-carbinolamine dehydratase
MHNKIVRIASSALTGGKLLEKLKPLTRWEVQWDPNKTKCLGITREVTFKDYETTWAFLTR
VSMRSHLWGHHPLIHTSYTWVKLELHTHDIDPKDGAHSQLSDIDVRMAKRIDSYIDEMTT
|
---|
References |
---|
External Links | |
---|
General Reference | - Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
- Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
|
---|