You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoacetylglucosamine mutase
Synonyms
  • PAGM
  • Acetylglucosamine phosphomutase
  • N-acetylglucosamine-phosphate mutase
Gene NamePCM1
Enzyme Class
Biological Properties
General FunctionInvolved in intramolecular transferase activity, phosphotransferases
Specific FunctionInterconverts GlcNAc-6-P and GlcNAc-1-P
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB Reactions
N-acetyl-D-glucosamine 6-phosphateN-Acetyl-glucosamine 1-phosphate
KEGG Reactions
N-acetyl-D-glucosamine 6-phosphateN-acetyl-alpha-D-glucosamine 1-phosphate
alpha-D-glucosamine 1-phosphateGlucosamine 6-phosphate
Metabolites
YMDB IDNameView
YMDB00043N-Acetyl-glucosamine 1-phosphateShow
YMDB00044Glucosamine 6-phosphateShow
YMDB00737N-acetyl-D-glucosamine 6-phosphateShow
YMDB00751N-acetyl-alpha-D-glucosamine 1-phosphateShow
YMDB00754alpha-D-glucosamine 1-phosphateShow
GO Classification
Component
Not Available
Function
ion binding
cation binding
metal ion binding
magnesium ion binding
phosphoacetylglucosamine mutase activity
isomerase activity
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
catalytic activity
binding
Process
carbohydrate metabolic process
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYEL058W
Gene Sequence>1674 bp ATGAAGGTTGATTACGAGCAATTGTGCAAACTCTACGATGACACGTGCCGCACAAAGAAT GTGCAGTTCAGTTACGGTACGGCCGGATTCAGAACGCTGGCCAAGAATTTGGATACGGTG ATGTTCAGTACTGGTATACTGGCGGTTCTCAGGTCGCTGAAGCTTCAGGGTCAGTATGTG GGGGTGATGATCACGGCGTCGCACAACCCATACCAGGACAACGGGGTCAAGATCGTGGAA CCAGACGGATCGATGCTTTTGGCCACATGGGAGCCATATGCCATGCAGTTGGCCAATGCG GCCTCTTTTGCCACTAATTTTGAAGAATTTCGTGTTGAGTTGGCCAAGCTGATTGAACAC GAAAAGATTGATTTGAATACAACCGTCGTGCCTCACATCGTGGTTGGGAGAGACTCTAGG GAAAGTAGTCCATACTTGCTGCGCTGCTTGACTTCCTCCATGGCCAGCGTCTTCCACGCG CAAGTTTTGGACCTAGGCTGTGTCACTACGCCTCAATTGCATTACATTACTGATTTGTCC AACAGGCGGAAACTGGAAGGAGACACAGCGCCAGTTGCCACAGAACAGGACTACTATTCG TTCTTTATAGGAGCCTTCAACGAGCTCTTCGCCACGTATCAGCTGGAGAAGAGGCTGTCT GTCCCAAAATTGTTCATAGACACAGCCAATGGTATCGGTGGTCCACAGTTGAAAAAACTA CTGGCCTCCGAAGATTGGGACGTGCCAGCGGAGCAAGTTGAGGTAATCAACGACAGGTCC GATGTTCCAGAACTGTTGAATTTTGAATGCGGTGCGGATTATGTGAAGACTAACCAGAGA TTACCCAAGGGTCTTTCTCCATCCTCGTTTGATTCGCTATATTGCTCCTTTGATGGTGAC GCAGACAGGGTTGTGTTCTACTATGTCGACTCAGGATCAAAATTTCATTTGTTGGATGGT GACAAAATTTCCACTTTGTTTGCAAAGTTCTTGTCTAAACAACTAGAATTGGCACACCTA GAACATTCTTTGAAGATTGGTGTTGTGCAAACTGCCTATGCAAACGGCAGTTCCACCGCT TACATAAAAAATACGTTGCACTGTCCCGTGTCTTGCACTAAGACAGGTGTTAAACACTTG CATCATGAAGCTGCCACTCAGTACGATATTGGCATTTATTTCGAAGCAAATGGACATGGT ACGATTATATTCAGCGAAAAATTTCATCGAACTATCAAATCTGAATTATCCAAGTCCAAG TTAAATGGTGATACGTTAGCTTTGAGAACTTTGAAGTGTTTCTCTGAATTGATTAATCAG ACCGTGGGAGATGCTATTTCAGACATGCTTGCTGTCCTTGCTACTTTGGCGATTTTGAAA ATGTCGCCAATGGATTGGGATGAAGAGTATACTGATTTGCCCAACAAGCTGGTTAAGTGC ATCGTTCCTGATAGGTCAATTTTCCAAACCACGGACCAGGAAAGAAAATTGCTCAATCCA GTGGGGTTGCAAGACAAGATAGATCTTGTGGTAGCCAAGTATCCCATGGGAAGAAGCTTT GTCAGAGCCAGTGGTACGGAGGATGCGGTGAGGGTTTATGCGGAATGTAAGGACTCCTCT AAGTTAGGTCAATTTTGTGACGAAGTGGTGGAGCACGTTAAGGCATCTGCTTGA
Protein Properties
Pfam Domain Function
Protein Residues557
Protein Molecular Weight62066.10156
Protein Theoretical pI5.75
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoacetylglucosamine mutase MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS KLGQFCDEVVEHVKASA
References
External Links
ResourceLink
Saccharomyces Genome Database PCM1
Uniprot IDP38628
Uniprot NameAGM1_YEAST
GenBank Gene IDU18795
Genebank Protein ID603260
General Reference
  • Boles, E., Liebetrau, W., Hofmann, M., Zimmermann, F. K. (1994). "A family of hexosephosphate mutases in Saccharomyces cerevisiae." Eur J Biochem 220:83-96.8119301
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hofmann, M., Boles, E., Zimmermann, F. K. (1994). "Characterization of the essential yeast gene encoding N-acetylglucosamine-phosphate mutase." Eur J Biochem 221:741-747.8174553
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956