You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRiboflavin synthase alpha chain
SynonymsNot Available
Gene NameRIB5
Enzyme Class
Biological Properties
General FunctionInvolved in riboflavin synthase activity
Specific Function2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine
Cellular LocationNot Available
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
6,7-Dimethyl-8-(1-D-ribityl)lumazineRiboflavin + 5-Amino-6-ribitylamino uracil
KEGG Reactions
6,7-Dimethyl-8-(1-D-ribityl)lumazineRiboflavin + 5-Amino-6-ribitylamino uracil
Metabolites
YMDB IDNameView
YMDB001715-Amino-6-ribitylamino uracilShow
YMDB00534RiboflavinShow
YMDB007655-Amino-6-(D-ribitylamino)uracilShow
YMDB007666,7-Dimethyl-8-(1-D-ribityl)lumazineShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring alkyl or aryl (other than methyl) groups
riboflavin synthase activity
catalytic activity
Process
metabolic process
nitrogen compound metabolic process
riboflavin metabolic process
riboflavin biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR256C
Gene Sequence>717 bp ATGTTTACTGGTATTGTAGAATGCATGGGGACTGTTTTGGAAAACAACCCATATGATGAC TCTGAAAGTGGAGGTCAAGGAGTTTCTATTACTATTGGCAATGCGGGGAGTATTCTCACC GATTGTCACGTTGGAGATTCAATAGCCGTAAATGGGGTATGCCTTACTGTGACCGAGTTT AATAACGACTCCTTCAAAGTTGGGATATCACCAGAAACTATAAAACGAAGTAATGTCGCT TCCTGGATTCAAGGCACCCAGGTCAACTTGGAGAGAGCGGTATCTCAAGACGTTAGGTTC GGTGGTCATTATGTACAGGGTCACGTAGACACTGTTGCTAATATTGTCTCAAGAAGACCT GAGGGGAATTCAATTATTTTTGGGTTTCAGTTAAGAGATCAAGAGTACTTTAAATACATA GTAGAAAAGGGATTCATTTGTATAGATGGAACTTCCTTGACCATAATCAAGGTTGACCCA CTTTCGCAAGGTGGAGCCTTCTATATTAGTATGATAAAGCACACCCAAGACAATGTTATC ATGCCTTTGAAGAAAATTGGCGACGAGGTTAATATTGAAGTAGATTTGACTGGGAAGATT ATTGAGAAGCAAATTCTATTAACGTTGGAAAACCAAATATCAAAGAAAGATAGTACTTTG AATACTATGATCTCAAACATTATCGAGGAGAAGGTTAGAAACTACCTAAATAAATAA
Protein Properties
Pfam Domain Function
Protein Residues238
Protein Molecular Weight26195.59961
Protein Theoretical pI4.81
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Riboflavin synthase alpha chain MFTGIVECMGTVLENNPYDDSESGGQGVSITIGNAGSILTDCHVGDSIAVNGVCLTVTEF NNDSFKVGISPETIKRSNVASWIQGTQVNLERAVSQDVRFGGHYVQGHVDTVANIVSRRP EGNSIIFGFQLRDQEYFKYIVEKGFICIDGTSLTIIKVDPLSQGGAFYISMIKHTQDNVI MPLKKIGDEVNIEVDLTGKIIEKQILLTLENQISKKDSTLNTMISNIIEEKVRNYLNK
References
External Links
ResourceLink
Saccharomyces Genome Database RIB5
Uniprot IDP38145
Uniprot NameRISA_YEAST
GenBank Gene IDX70529
Genebank Protein ID1907247
General Reference
  • Santos, M. A., Garcia-Ramirez, J. J., Revuelta, J. L. (1995). "Riboflavin biosynthesis in Saccharomyces cerevisiae. Cloning, characterization, and expression of the RIB5 gene encoding riboflavin synthase." J Biol Chem 270:437-444.7814407
  • Doignon, F., Biteau, N., Crouzet, M., Aigle, M. (1993). "The complete sequence of a 19,482 bp segment located on the right arm of chromosome II from Saccharomyces cerevisiae." Yeast 9:189-199.8465606
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956