Peroxiredoxin type-2 (P38013)

Identification
NamePeroxiredoxin type-2
Synonyms
  • AHPC1
  • Cytoplasmic thiol peroxidase 3
  • cTPx 3
  • Peroxiredoxin type II
  • Peroxisomal alkyl hydroperoxide reductase
  • TPx type II
  • Thiol-specific antioxidant II
  • TSA II
  • Thioredoxin peroxidase type II
  • Thioredoxin reductase type II
Gene NameAHP1
Enzyme Class
Biological Properties
General FunctionPosttranslational modification, protein turnover, chaperones
Specific FunctionThiol-specific antioxidant protein with alkyl hydroperoxidase activity. Involved in osmotic stress resistance and detoxification of the cell. Preferentially eliminates organic peroxides rather than H(2)O(2). Involved in cellular Mn(2+) homeostasis
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
catalytic activity
oxidoreductase activity
Process
cellular process
cellular homeostasis
cell redox homeostasis
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>531 bp ATGTCTGACTTAGTTAACAAGAAATTCCCAGCTGGCGACTACAAATTCCAATACATTGCT ATCAGCCAAAGTGATGCTGACAGTGAATCTTGTAAGATGCCACAAACAGTTGAATGGTCC AAATTAATTTCTGAAAACAAGAAGGTTATCATTACCGGTGCTCCAGCTGCTTTCTCCCCA ACCTGTACTGTCAGCCATATTCCAGGTTACATCAACTACTTGGATGAATTAGTTAAGGAA AAGGAAGTTGACCAAGTGATCGTTGTTACTGTTGACAACCCGTTCGCTAACCAAGCGTGG GCTAAGAGTTTAGGTGTTAAGGACACCACACACATCAAGTTTGCCTCCGACCCAGGCTGT GCTTTCACCAAATCCATTGGTTTCGAATTAGCCGTCGGTGACGGTGTTTACTGGAGTGGT AGATGGGCCATGGTTGTTGAAAACGGTATCGTTACTTACGCTGCCAAGGAAACCAACCCA GGTACCGATGTGACCGTTTCCTCAGTCGAAAGTGTCTTGGCTCATTTGTAG
Protein Properties
Pfam Domain Function
Protein Residues176
Protein Molecular Weight19114.5
Protein Theoretical pI4.78
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peroxiredoxin type-2 MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSP TCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGC AFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
References
External Links
ResourceLink
Saccharomyces Genome Database AHP1
Uniprot IDP38013
Uniprot NameAHP1_YEAST
GenBank Gene IDU53878
Genebank Protein ID1256872
General Reference
  • Verhasselt, P., Volckaert, G. (1997). "Sequence analysis of a 37.6 kbp cosmid clone from the right arm of Saccharomyces cerevisiae chromosome XII, carrying YAP3, HOG1, SNR6, tRNA-Arg3 and 23 new open reading frames, among which several homologies to proteins involved in cell division control and to mammalian growth factors and other animal proteins are found." Yeast 13:241-250.9090053
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Goehring, A. S., Rivers, D. M., Sprague, G. F. Jr (2003). "Attachment of the ubiquitin-related protein Urm1p to the antioxidant protein Ahp1p." Eukaryot Cell 2:930-936.14555475
  • Jeong, J. S., Kwon, S. J., Kang, S. W., Rhee, S. G., Kim, K. (1999). "Purification and characterization of a second type thioredoxin peroxidase (type II TPx) from Saccharomyces cerevisiae." Biochemistry 38:776-783.9888818
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Lee, J., Spector, D., Godon, C., Labarre, J., Toledano, M. B. (1999). "A new antioxidant with alkyl hydroperoxide defense properties in yeast." J Biol Chem 274:4537-4544.9988687
  • Farcasanu, I. C., Hirata, D., Tsuchiya, E., Mizuta, K., Miyakawa, T. (1999). "Involvement of thioredoxin peroxidase type II (Ahp1p) of Saccharomyces cerevisiae in Mn2+ homeostasis." Biosci Biotechnol Biochem 63:1871-1881.10635552
  • Park, S. G., Cha, M. K., Jeong, W., Kim, I. H. (2000). "Distinct physiological functions of thiol peroxidase isoenzymes in Saccharomyces cerevisiae." J Biol Chem 275:5723-5732.10681558
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Trivelli, X., Krimm, I., Ebel, C., Verdoucq, L., Prouzet-Mauleon, V., Chartier, Y., Tsan, P., Lauquin, G., Meyer, Y., Lancelin, J. M. (2003). "Characterization of the yeast peroxiredoxin Ahp1 in its reduced active and overoxidized inactive forms using NMR." Biochemistry 42:14139-14149.14640681
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106