Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name1,4-alpha-glucan-branching enzyme
Synonyms
  • Glycogen-branching enzyme
Gene NameGLC3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionTransfers a segment of a (1->4)-alpha-D-glucan chain to a primary hydroxy group in a similar glucan chain
Cellular LocationCytoplasmic
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
AmyloseGlycogen
KEGG Reactions
amylose → Glycogen + water
Metabolites
YMDB IDNameView
YMDB00881GlycogenShow
YMDB00890waterShow
YMDB16158AmyloseShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYEL011W
Gene Sequence>2115 bp ATGTACAACATTCCAGATAATGTCAAAGGGGCTGTAGAATTTGATCCATGGTTGAAACCG TTTGCCGATGTACTTTCTGAAAGAAGATACCTAGCTGACAAGTGGTTGTACGACATAACT CATGCTACGCCTGATGGTTCGTATCAGTCACTCAGTAAGTTTGCTAGAGATTCATACAAG TCATATGGGTTGCATGCCAATCCGGAAACCAAAGAAATCACTTACAAAGAGTGGGCACCC AATGCGGAACGTGCATTTCTAGTGGGAGATTTCAATAACTGGGATACCACATCTCATGAG CTCAAGAACAAGGACGAATTTGGAAATTTTACAATCACACTTCATCCTTTACCTAACGGC GATTTCGCCATCCCTCATGATTCGAAGATTAAAGTCATGTTTATTTTGCCAGATGGTTCC AAGATCTTTCGTTTACCTGCGTGGATCACAAGGGCTACACAGCCTTCTAAGGAAACTTCT AAACAGTTCGGGCCCGCATATGAAGGTAGGTTTTGGAATCCAGAGAACCCCTACAAATTT GTACATCCAAGGCCAAAGTTTAGTGAATCTGTAGATTCCTTAAGGATTTATGAAGCCCAC GTCGGTATTTCGAGTCCAGAACCAAAGATAACCACATATAAAGAATTTACTGAGAAGGTC TTACCCAGAATCAAATATCTTGGCTACGATGCAATTCAATTAATGGCTATTATGGAACAT GCTTATTATGCATCATTTGGCTACCAAGTGACCAATTTTTTTGCGGCGAGCTCCCGTTTC GGCACCCCTGAGGAATTAAAGGAGCTGATTGATACTGCACATTCTATGGGCATCCTAGTT TTATTGGATGTAGTTCATAGCCATGCTTCTAAAAACGTCGAGGATGGGTTGAACATGTTT GACGGTTCTGATCATCAGTATTTCCATTCTATAAGCTCCGGTAGGGGTGAGCATCCGCTG TGGGATTCCCGTCTTTTTAATTACGGAAAATTTGAAGTGCAGCGATTCTTATTAGCAAAC CTGGCATTTTATGTTGACGTTTATCAGTTTGATGGGTTTAGATTCGATGGTGTCACATCA ATGTTATACGTTCATCATGGTGTTGGTGCCGGTGGGTCTTTTAGCGGTGACTATAACGAA TATCTTTCTCGTGACAGGTCCTTCGTCGATCATGAAGCCTTAGCTTATTTAATGTTAGCC AATGATTTGGTTCACGAAATGTTGCCAAATCTGGCTGTAACTGTTGCAGAAGATGTCTCT GGTTATCCAACTTTATGTTTACCCCGCTCCATAGGTGGTACTGGTTTCGACTACAGATTA GCAATGGCTTTGCCTGATATGTGGATCAAACTAATCAAGGAGAAGAAAGATGATGAATGG GAGATGGGAAGTATTGTATACACTTTAACTAATAGACGATATGGTGAAAAAGTGGTTGCT TATTGTGAGTCGCACGACCAAGCTTTAGTTGGTGATAAGACATTAGCGTTTTGGTTGATG GATGCCGCTATGTACACCGATATGACTGTATTGAAGGAACCATCCATCGTTATTGACCGT GGTATTGCTCTACACAAGATGATTAGGCTGATCACTCACTCGCTGGGAGGCGAGGCTTAT TTGAACTTCGAAGGTAATGAGTTCGGTCATCCAGAATGGTTGGATTTCCCTAATGTTAAC AATGGCGATACGTACAAGTATGCTCGTAGGCAGTTTAATTTGGCTGATGATCCCTTACTG CGTTACCAGAATTTAAATGAGTTTGATAGATCAATGCAATTATGTGAGAAAAGGCATAAG TGGCTGAACACGAAACAGGCTTATGTTTCATTAAAACATGAAGGTGACAAAATGATTGTG TTTGAAAGAAATAATCTGTTGTTTATTTTCAACTTCCATCCTACAAACAGCTACAGCGAT TATAGAGTTGGTGTCGAAAAAGCTGGTACTTATCACATCGTGTTGAACTCAGATCGTGCT GAATTTGGTGGACATAACAGAATCAACGAAAGTTCCGAATTCTTTACCACCGATTTGGAA TGGAACAACAGGAAGAACTTCCTCCAAGTTTATATTCCTAGTAGAGTCGCTTTGGTGCTT GCCTTAAAAGAATGA
Protein Properties
Pfam Domain Function
Protein Residues704
Protein Molecular Weight81114.89844
Protein Theoretical pI6.1
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>1,4-alpha-glucan-branching enzyme MYNIPDNVKGAVEFDPWLKPFADVLSERRYLADKWLYDITHATPDGSYQSLSKFARDSYK SYGLHANPETKEITYKEWAPNAERAFLVGDFNNWDTTSHELKNKDEFGNFTITLHPLPNG DFAIPHDSKIKVMFILPDGSKIFRLPAWITRATQPSKETSKQFGPAYEGRFWNPENPYKF VHPRPKFSESVDSLRIYEAHVGISSPEPKITTYKEFTEKVLPRIKYLGYDAIQLMAIMEH AYYASFGYQVTNFFAASSRFGTPEELKELIDTAHSMGILVLLDVVHSHASKNVEDGLNMF DGSDHQYFHSISSGRGEHPLWDSRLFNYGKFEVQRFLLANLAFYVDVYQFDGFRFDGVTS MLYVHHGVGAGGSFSGDYNEYLSRDRSFVDHEALAYLMLANDLVHEMLPNLAVTVAEDVS GYPTLCLPRSIGGTGFDYRLAMALPDMWIKLIKEKKDDEWEMGSIVYTLTNRRYGEKVVA YCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPSIVIDRGIALHKMIRLITHSLGGEAY LNFEGNEFGHPEWLDFPNVNNGDSYKYARRQFNLADDPLLRYQNLNEFDRSMQLCEKRHK WLNTKQAYVSLKHEGDKMIVFERNNLLFIFNFHPTNSYSDYRVGVEKAGTYHIVLNSDRA EFGGHNRINESSEFFTTDLEWNNRKNFLQVYIPSRVALVLALKE
References
External Links
ResourceLink
Saccharomyces Genome Database GLC3
Uniprot IDP32775
Uniprot NameGLGB_YEAST
GenBank Gene IDM76739
Genebank Protein ID171569
General Reference
  • Thon, V. J., Vigneron-Lesens, C., Marianne-Pepin, T., Montreuil, J., Decq, A., Rachez, C., Ball, S. G., Cannon, J. F. (1992). "Coordinate regulation of glycogen metabolism in the yeast Saccharomyces cerevisiae. Induction of glycogen branching enzyme." J Biol Chem 267:15224-15228.1634552
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956