You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCystathionine beta-synthase
Synonyms
  • Beta-thionase
  • Serine sulfhydrase
  • Sulfur transfer protein 4
Gene NameCYS4
Enzyme Class
Biological Properties
General FunctionInvolved in cysteine biosynthetic process from serine
Specific FunctionL-serine + L-homocysteine = L-cystathionine + H(2)O
Cellular LocationNot Available
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Glycine, serine and threonine metabolismec00260 Map00260
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Homocysteine + L-Serinewater + L-Cystathionine
KEGG Reactions
L-Homocysteine + L-SerineL-Cystathionine + water
Metabolites
YMDB IDNameView
YMDB00112L-SerineShow
YMDB00245L-CystathionineShow
YMDB00371HomocysteineShow
YMDB00520L-HomocysteineShow
YMDB00890waterShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
lyase activity
carbon-oxygen lyase activity
hydro-lyase activity
binding
cystathionine beta-synthase activity
cofactor binding
catalytic activity
pyridoxal phosphate binding
Process
serine family amino acid metabolic process
L-serine metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
sulfur amino acid metabolic process
cellular amino acid metabolic process
sulfur amino acid biosynthetic process
cysteine biosynthetic process from serine
cysteine biosynthetic process
cysteine biosynthetic process via cystathionine
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR155W
Gene Sequence>1524 bp ATGACTAAATCTGAGCAGCAAGCCGATTCAAGACATAACGTTATCGACTTAGTTGGTAAC ACCCCATTGATCGCACTGAAAAAATTGCCTAAGGCTTTGGGTATCAAACCACAAATTTAT GCTAAGCTGGAACTATACAATCCAGGTGGTTCCATCAAAGACAGAATTGCCAAGTCTATG GTGGAAGAAGCTGAAGCTTCCGGTAGAATTCATCCTTCCAGATCTACTCTGATCGAACCT ACTTCTGGTAACACCGGTATCGGTCTAGCTTTAATCGGCGCCATCAAAGGTTACAGAACT ATCATCACCTTGCCGGAAAAAATGTCTAACGAGAAAGTTTCTGTCCTAAAGGCTCTGGGT GCTGAAATCATCAGAACTCCAACTGCTGCTGCCTGGGATTCTCCAGAATCACATATTGGT GTTGCTAAGAAGTTGGAAAAAGAGATTCCTGGTGCTGTTATACTTGACCAATATAACAAT ATGATGAACCCAGAAGCTCATTACTTTGGTACTGGTCGCGAAATCCAAAGACAGCTAGAA GACTTGAATTTATTTGATAATCTACGCGCTGTTGTTGCTGGTGCTGGTACTGGTGGGACT ATTAGCGGTATTTCCAAGTACTTGAAAGAACAGAATGATAAGATCCAAATCGTTGGTGCT GACCCATTCGGTTCAATTTTAGCCCAACCTGAAAACTTGAATAAGACTGATATCACTGAC TACAAAGTTGAGGGTATTGGTTATGATTTTGTTCCTCAGGTTTTGGACAGAAAATTAATT GATGTTTGGTATAAGACAGACGACAAGCCTTCTTTCAAATACGCCAGACAATTGATTTCT AACGAAGGTGTCTTGGTGGGTGGTTCTTCCGGTTCTACCTTCACTGCGGTTGTGAAATAC TGTGAAGACCACCCTGAACTGACTGAAGATGATGTCATTGTTGCCATATTCCCAGATTCC ATCAGGTCGTACCTAACCAAATTCGTCGATGACGAATGGTTGAAAAAGAACAATTTGTGG GATGATGACGTGTTGGCCCGTTTTGACTCTTCAAAGCTGGAGGCTTCGACGACAAAATAC GCTGATGTGTTTGGTAACGCTACTGTAAAGGATCTTCACTTGAAACCGGTTGTTTCCGTT AAGGAAACCGCTAAGGTCACTGATGTTATCAAGATATTAAAAGACAATGGCTTTGACCAA TTGCCTGTGTTGACTGAAGACGGCAAGTTGTCTGGTTTAGTTACTCTCTCTGAGCTTCTA AGAAAACTATCAATCAATAATTCAAACAACGACAACACTATAAAGGGTAAATACTTGGAC TTCAAGAAATTAAACAATTTCAATGATGTTTCCTCTTACAACGAAAATAAATCCGGTAAG AAGAAGTTTATTAAATTCGATGAAAACTCAAAGCTATCTGACTTGAATCGTTTCTTTGAA AAAAACTCATCTGCCGTTATCACTGATGGCTTGAAACCAATCCATATCGTTACTAAGATG GATTTACTGAGCTACTTAGCATAA
Protein Properties
Pfam Domain Function
Protein Residues507
Protein Molecular Weight56021.30078
Protein Theoretical pI6.66
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cystathionine beta-synthase MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSM VEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALG AEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLE DLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITD YKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKY CEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVLARFDSSKLEASTTKY ADVFGNATVKDLHLKPVVSVKETAKVTDVIKILKDNGFDQLPVLTEDGKLSGLVTLSELL RKLSINNSNNDNTIKGKYLDFKKLNNFNDVSSYNENKSGKKKFIKFDENSKLSDLNRFFE KNSSAVITDGLKPIHIVTKMDLLSYLA
References
External Links
ResourceLink
Saccharomyces Genome Database CYS4
Uniprot IDP32582
Uniprot NameCBS_YEAST
GenBank Gene IDD16502
Genebank Protein ID416161
General Reference
  • Cherest, H., Thomas, D., Surdin-Kerjan, Y. (1993). "Cysteine biosynthesis in Saccharomyces cerevisiae occurs through the transsulfuration pathway which has been built up by enzyme recruitment." J Bacteriol 175:5366-5374.8366024
  • Kruger, W. D., Cox, D. R. (1994). "A yeast system for expression of human cystathionine beta-synthase: structural and functional conservation of the human and yeast genes." Proc Natl Acad Sci U S A 91:6614-6618.8022826
  • Skala, J., Nawrocki, A., Goffeau, A. (1995). "The sequence of a 27 kb segment on the right arm of chromosome VII from Saccharomyces cerevisiae reveals MOL1, NAT2, RPL30B, RSR1, CYS4, PEM1/CHO2, NSR1 genes and ten new open reading frames." Yeast 11:1421-1427.8585325
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956