You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeroxisomal 2,4-dienoyl-CoA reductase SPS19
Synonyms
  • Sporulation-specific protein SPX19
Gene NameSPS19
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionAuxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Dispensable for growth and sporulation on solid acetate and oleate media, but is essential for these processes to occur on petroselineate
Cellular LocationPeroxisome
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL202W
Gene Sequence>888 bp ATGGATACTATGAATACAGCAAACACTTTGGACGGCAAATTCGTTACTGAGGGTTCTTGG AGACCTGATTTATTTAAGGGTAAAGTGGCATTTGTCACTGGTGGAGCTGGCACGATATGT CGGGTACAGACAGAAGCCTTGGTTCTTCTTGGCTGTAAGGCAGCTATTGTCGGCAGGGAC CAAGAAAGAACAGAACAGGCAGCAAAAGGTATTTCGCAGTTAGCAAAGGACAAAGATGCA GTCTTGGCTATTGCAAACGTCGATGTTCGCAATTTTGAACAAGTGGAGAATGCGGTTAAA AAGACCGTAGAGAAGTTCGGTAAGATCGATTTCGTCATTGCCGGTGCTGCTGGAAATTTT GTGTGCGATTTTGCGAACCTCTCTCCAAACGCCTTCAAATCTGTTGTTGACATAGATTTA CTAGGAAGTTTTAATACCGCCAAGGCATGCTTGAAGGAGTTAAAAAAGTCAAAAGGTTCC ATCCTTTTCGTCTCTGCCACTTTCCATTATTATGGTGTGCCGTTTCAAGGACATGTGGGC GCTGCTAAAGCGGGAATAGACGCATTGGCAAAGAATTTAGCGGTTGAGTTGGGGCCTCTG GGTATACGTTCGAATTGCATTGCTCCAGGTGCTATCGATAATACGGAAGGCTTGAAGAGA TTAGCCGGCAAAAAATATAAGGAAAAGGCCTTGGCAAAGATACCATTACAAAGGCTTGGA TCTACACGGGATATAGCCGAATCTACTGTTTATATTTTTTCACCCGCCGCATCGTATGTC ACCGGTACCGTCTTAGTTGTTGACGGTGGTATGTGGCATTTAGGGACCTATTTTGGACAT GAGTTGTATCCAGAAGCCTTAATAAAGAGTATGACATCTAAATTATAA
Protein Properties
Pfam Domain Function
Protein Residues292
Protein Molecular Weight31108.69922
Protein Theoretical pI9.48
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peroxisomal 2,4-dienoyl-CoA reductase SPS19 MNTANTLDGKFVTEGSWRPDLFKGKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQER TEQAAKGISQLAKDKDAVLAIANVDVRNFEQVENAVKKTVEKFGKIDFVIAGAAGNFVCD FANLSPNAFKSVVDIDLLGSFNTAKACLKELKKSKGSILFVSATFHYYGVPFQGHVGAAK AGIDALAKNLAVELGPLGIRSNCIAPGAIDNTEGLKRLAGKKYKEKALAKIPLQRLGSTR DIAESTVYIFSPAASYVTGTVLVVDGGMWHLGTYFGHELYPEALIKSMTSKL
References
External Links
ResourceLink
Saccharomyces Genome Database SPS19
Uniprot IDP32573
Uniprot NameSPS19_YEAST
GenBank Gene IDAY693119
Genebank Protein ID51013689
General Reference
  • Jonniaux, J. L., Coster, F., Purnelle, B., Goffeau, A. (1994). "A 21.7 kb DNA segment on the left arm of yeast chromosome XIV carries WHI3, GCR2, SPX18, SPX19, an homologue to the heat shock gene SSB1 and 8 new open reading frames of unknown function." Yeast 10:1639-1645.7725799
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Coe, J. G., Murray, L. E., Dawes, I. W. (1994). "Identification of a sporulation-specific promoter regulating divergent transcription of two novel sporulation genes in Saccharomyces cerevisiae." Mol Gen Genet 244:661-672.7969036
  • Gurvitz, A., Rottensteiner, H., Kilpelainen, S. H., Hartig, A., Hiltunen, J. K., Binder, M., Dawes, I. W., Hamilton, B. (1997). "The Saccharomyces cerevisiae peroxisomal 2,4-dienoyl-CoA reductase is encoded by the oleate-inducible gene SPS19." J Biol Chem 272:22140-22147.9268358
  • Gurvitz, A., Rottensteiner, H., Hiltunen, J. K., Binder, M., Dawes, I. W., Ruis, H., Hamilton, B. (1997). "Regulation of the yeast SPS19 gene encoding peroxisomal 2,4-dienoyl-CoA reductase by the transcription factors Pip2p and Oaf1p: beta-oxidation is dispensable for Saccharomyces cerevisiae sporulation in acetate medium." Mol Microbiol 26:675-685.9427398
  • Gurvitz, A., Wabnegger, L., Rottensteiner, H., Dawes, I. W., Hartig, A., Ruis, H., Hamilton, B. (2000). "Adr1p-dependent regulation of the oleic acid-inducible yeast gene SPS19 encoding the peroxisomal beta-oxidation auxiliary enzyme 2,4-dienoyl-CoA reductase." Mol Cell Biol Res Commun 4:81-89.11170837