Identification |
---|
Name | Mating factor alpha-2 |
---|
Synonyms | |
---|
Gene Name | MF(ALPHA)2 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
---|
Specific Function | The active factor is excreted into the culture medium by haploid cells of the alpha mating type and acts on cells of the opposite mating type (type A). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis in type a cells and synchronizing them with type alpha. |
---|
Cellular Location | Not Available |
---|
SMPDB Pathways | Stress-activated signalling pathways: pheromone stress test 1 | PW012843 | |
|
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | |
---|
GO Classification | Function |
---|
pheromone-dependent signal transduction involved in conjugation with cellular fusion | extracellular region | mating pheromone activity | mating |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | >363 bp
ATGAAATTCATTTCTACCTTTCTCACTTTTATTTTAGCGGCCGTTTCTGTCACTGCTAGT
TCCGATGAAGATATCGCTCAGGTGCCAGCCGAGGCCATTATTGGATACTTGGATTTCGGA
GGTGATCATGACATAGCTTTTTTACCATTCAGTAACGCTACCGCCAGTGGGCTATTGTTT
ATCAACACCACTATTGCTGAGGCGGCTGAAAAAGAGCAAAACACCACTTTGGCGAAAAGA
GAGGCTGTTGCCGACGCTTGGCACTGGTTAAATTTGAGACCAGGCCAACCAATGTACAAG
AGAGAGGCCAACGCTGATGCTTGGCACTGGTTGCAACTCAAGCCAGGCCAACCAATGTAC
TGA |
---|
Protein Properties |
---|
Pfam Domain Function | Not Available |
---|
Protein Residues | 120 |
---|
Protein Molecular Weight | 13270.895 |
---|
Protein Theoretical pI | Not Available |
---|
Signalling Regions | |
---|
Transmembrane Regions | Not Available |
---|
Protein Sequence | >Mating factor alpha-2
MKFISTFLTFILAAVSVTASSDEDIAQVPAEAIIGYLDFGGDHDIAFLPFSNATASGLLF
INTTIAEAAEKEQNTTLAKREAVADAWHWLNLRPGQPMYKREANADAWHWLQLKPGQPMY
|
---|
References |
---|
External Links | |
---|
General Reference | Not Available |
---|