You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAspartic proteinase 3
Synonyms
  • Proprotein convertase
  • Yapsin-1
Gene NameYPS1
Enzyme ClassNot Available
Biological Properties
General Functionsignal transduction involved in filamentous growth
Specific FunctionCleaves proteins C-terminally to mono- and paired-basic residues. Involved in the shedding of a subset of GPI-anchored plasma membrane proteins from the cell surface, including itself, GAS1 and MSB2. May also play a role in the maturation of GPI-mannoproteins associated with the cell wall. Can process the alpha-mating factor precursor. Required for cell wall integrity.
Cellular LocationNot Available
SMPDB Pathways
Stress-activated signalling pathways: starvation test 1PW003483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
signal transduction involved in filamentous growth
aspartic-type endopeptidase activity
protein catabolic process
fungal-type cell wall organization
anchored component of plasma membrane
peptide mating pheromone maturation involved in conjugation with cellular fusion
protein processing
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1710 bp ATGAAACTGAAAACTGTAAGATCTGCGGTCCTTTCGTCACTCTTTGCATCGCAGGTTCTC GGTAAGATAATACCAGCAGCAAACAAGCGCGACGACGACTCGAATTCCAAGTTCGTCAAG TTGCCCTTTCATAAGCTTTACGGGGACTCGCTAGAAAATGTGGGAAGCGACAAAAAACCG GAAGTACGCCTATTGAAGAGGGCTGACGGTTATGAAGAAATTATAATTACCAACCAGCAA AGTTTCTATTCGGTGGACTTGGAAGTGGGCACGCCACCACAGAACGTAACGGTCCTGGTG GACACAGGCTCCTCTGATCTATGGATTATGGGCTCGGATAATCCATACTGTTCTTCGAAC AGTATGGGTAGTAGCCGGAGACGTGTTATTGACAAACGTGATGATTCGTCAAGCGGCGGA TCTTTGATTAATGATATAAACCCATTTGGCTGGTTGACGGGAACGGGCAGTGCCATTGGC CCCACTGCTACGGGCTTAGGAGGCGGTTCAGGTACGGCAACTCAATCCGTGCCTGCTTCG GAAGCCACCATGGACTGTCAACAATACGGGACATTTTCCACTTCGGGCTCTTCTACATTT AGATCAAACAACACCTATTTCAGTATTAGCTACGGTGATGGGACTTTTGCCTCCGGTACT TTTGGTACGGATGTTTTGGATTTAAGCGACTTGAACGTTACCGGGTTGTCTTTTGCCGTT GCCAATGAAACGAATTCTACTATGGGTGTGTTAGGTATTGGTTTGCCCGAATTAGAAGTC ACTTATTCTGGCTCTACTGCGTCTCATAGTGGAAAAGCTTATAAATACGACAACTTCCCC ATTGTATTGAAAAATTCTGGTGCTATCAAAAGCAACACATATTCTTTGTATTTGAACGAC TCGGACGCTATGCATGGCACCATTTTGTTCGGAGCCGTGGACCACAGTAAATATACCGGC ACCTTATACACAATCCCCATCGTAAACACTCTGAGTGCTAGTGGATTTAGCTCTCCCATT CAATTTGATGTCACTATTAATGGTATCGGTATTAGTGATTCTGGGAGTAGTAACAAGACC TTGACTACCACTAAAATACCTGCTTTGTTGGATTCCGGTACTACTTTGACTTATTTACCT CAAACAGTGGTAAGTATGATCGCTACTGAACTAGGTGCGCAATACTCTTCCAGGATAGGG TATTACGTATTGGACTGTCCATCTGATGATAGTATGGAAATAGTGTTCGATTTTGGTGGT TTTCACATCAATGCACCACTTTCGAGTTTTATCTTGAGTACTGGCACTACATGTCTTTTA GGTATTATCCCAACGAGTGATGACACAGGTACCATTTTGGGTGATTCATTTTTGACTAAC GCGTACGTGGTTTATGATTTGGAGAATCTTGAAATATCCATGGCACAAGCTCGCTATAAT ACCACAAGCGAAAATATCGAAATTATTACATCCTCTGTTCCAAGCGCCGTAAAGGCACCA GGCTATACAAACACTTGGTCCACAAGTGCATCTATTGTTACCGGTGGTAACATATTTACT GTAAATTCCTCACAAACTGCTTCCTTTAGCGGTAACCTGACGACCAGTACTGCATCCGCC ACTTCTACATCAAGTAAAAGAAATGTTGGTGATCATATAGTTCCATCTTTACCCCTCACA TTAATTTCTCTTCTTTTTGCATTCATCTGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues569
Protein Molecular Weight60009.13
Protein Theoretical pINot Available
PDB Fileshow
Signalling Regions
  • 1-21
Transmembrane RegionsNot Available
Protein Sequence>Aspartic proteinase 3 MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKP EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSN SMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSAIGPTATGLGGGSGTATQSVPAS EATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV ANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLND SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNKT LTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGG FHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN TTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNLTTSTASA TSTSSKRNVGDHIVPSLPLTLISLLFAFI
References
External Links
ResourceLink
Saccharomyces Genome Database YPS1
Uniprot IDP32329
Uniprot NameYPS1
PDB ID
1YPS
General ReferenceNot Available