You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameChorismate mutase
Synonyms
  • CM
Gene NameARO7
Enzyme Class
Biological Properties
General FunctionInvolved in chorismate mutase activity
Specific FunctionChorismate = prephenate
Cellular LocationNot Available
SMPDB Pathways
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Phenylalanine metabolismec00360 Map00360
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB Reactions
ChorismatePrephenate
KEGG Reactions
ChorismatePrephenate
Metabolites
YMDB IDNameView
YMDB00148ChorismateShow
YMDB00324PrephenateShow
GO Classification
Component
Not Available
Function
chorismate mutase activity
catalytic activity
isomerase activity
intramolecular transferase activity
Process
chorismate metabolic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
aromatic amino acid family biosynthetic process
dicarboxylic acid metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR060C
Gene Sequence>771 bp ATGGATTTCACAAAACCAGAAACTGTTTTAAATCTACAAAATATTAGAGATGAATTAGTT AGAATGGAGGATTCGATCATCTTCAAATTTATTGAGAGGTCGCATTTCGCCACATGTCCT TCAGTTTATGAGGCAAACCATCCAGGTTTAGAAATTCCGAATTTTAAAGGATCTTTCTTG GATTGGGCTCTTTCAAATCTTGAAATTGCGCATTCTCGCATCAGAAGATTCGAATCACCT GATGAAACTCCCTTCTTTCCTGACAAGATTCAGAAATCATTCTTACCGAGCATTAACTAC CCACAAATTTTGGCGCCTTATGCCCCAGAAGTTAATTACAATGATAAAATAAAAAAAGTT TATATTGAAAAGATTATACCATTAATTTCGAAAAGAGATGGTGATGATAAGAATAACTTC GGTTCTGTTGCCACTAGAGATATAGAATGTTTGCAAAGCTTGAGTAGGAGAATCCACTTT GGCAAGTTTGTTGCTGAAGCCAAGTTCCAATCGGATATCCCGCTATACACAAAGCTGATC AAAAGTAAAGATGTCGAGGGGATAATGAAGAATATCACCAATTCTGCCGTTGAAGAAAAG ATTCTAGAAAGATTAACTAAGAAGGCTGAAGTCTATGGTGTGGACCCTACCAACGAGTCA GGTGAAAGAAGGATTACTCCAGAATATTTGGTAAAAATTTATAAGGAAATTGTTATACCT ATCACTAAGGAAGTTGAGGTGGAATACTTGCTAAGAAGGTTGGAAGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues256
Protein Molecular Weight29746.80078
Protein Theoretical pI6.17
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Chorismate mutase MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFL DWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKV YIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLI KSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTNESGERRITPEYLVKIYKEIVIP ITKEVEVEYLLRRLEE
References
External Links
ResourceLink
Saccharomyces Genome Database ARO7
Uniprot IDP32178
Uniprot NameCHMU_YEAST
GenBank Gene IDAY693179
Genebank Protein ID51013809
PDB ID
4CSM
General Reference
  • Schmidheini, T., Sperisen, P., Paravicini, G., Hutter, R., Braus, G. (1989). "A single point mutation results in a constitutively activated and feedback-resistant chorismate mutase of Saccharomyces cerevisiae." J Bacteriol 171:1245-1253.2646272
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Xue, Y., Lipscomb, W. N., Graf, R., Schnappauf, G., Braus, G. (1994). "The crystal structure of allosteric chorismate mutase at 2.2-A resolution." Proc Natl Acad Sci U S A 91:10814-10818.7971967
  • Strater, N., Hakansson, K., Schnappauf, G., Braus, G., Lipscomb, W. N. (1996). "Crystal structure of the T state of allosteric yeast chorismate mutase and comparison with the R state." Proc Natl Acad Sci U S A 93:3330-3334.8622937
  • Strater, N., Schnappauf, G., Braus, G., Lipscomb, W. N. (1997). "Mechanisms of catalysis and allosteric regulation of yeast chorismate mutase from crystal structures." Structure 5:1437-1452.9384560