You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA pseudouridine synthase 3
Synonyms
  • Depressed growth-rate protein DEG1
  • tRNA pseudouridylate synthase 3
  • tRNA-uridine isomerase 3
Gene NamePUS3
Enzyme Class
Biological Properties
General FunctionInvolved in RNA binding
Specific FunctionFormation of pseudouridines at positions 38 and 39 in the anticodon stem and loop of transfer RNAs
Cellular LocationNucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Uracil + alpha-D-ribose 5-phosphatewater + Pseudouridine 5'-phosphate
Metabolites
YMDB IDNameView
YMDB00098UracilShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00780Pseudouridine 5'-phosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
isomerase activity
intramolecular transferase activity
nucleic acid binding
pseudouridine synthase activity
RNA binding
Process
RNA modification
pseudouridine synthesis
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1329 bp ATGAGTAATTTCATTAGAAGGCTAGTTGGGAAAATGAAAGCGATTTCAACAGGTACCAAT GCTATTGTTAGTAAGAAGGACTCCATTTACGCAAACTGGTCCAAAGAGCAGCTAATACGA AGGATCACTGAACTAGAAAACGCAAATAAGCCACATTCTGAAAAATTCCAGCACATCGAG GATAACAAAAAGCGCAAAATTTCGCAAGAAGAGGTTACGAGAAGCAAGGCGAAAAAGGCT CCGAAGAAGTTTGACTTTTCTAAACATAATACCAGGTTCATCGCCTTGAGATTTGCCTAT TTGGGATGGAATTACAATGGCTTAGCTGTTCAGAAGGAATACACACCGTTGCCTACAGTA GAGGGTACCATTTTGGAGGCCATGAATAAGTGTAAACTTGTTCCCTCGATGGTTTTACAA GACTATAAATTTAGCAGATGTGGCAGAACAGACAAGGGAGTTAGCGCCATGAACCAAGTT ATATCGTTAGAAGTCCGTTCCAATTTAACAGATGAGGAACAGCGGGATCCGACCAACGAC AGCAGGGAAATACCCTATGTTCACGTTTTAAATCAATTACTACCCGACGATATTCGTATA TCAGCTGTCTGCCTCAGACCGCCACCTAACTTTGACGCAAGATTCAGCTGTGTTCACCGG CACTATAAGTACATCTTTAATGGAAAAAACCTTAATATTGAAAAAATGTCTAAAGCCGCA TCATATTTTGTTGGAGAGAGAGACTTCAGGAATTTTTGTAAGCTTGATGGCTCAAAACAA ATTACCAATTTTAAACGAACAATAATAAGCTCAAAAATTCTTCCCCTTTCTGAAACTTTC TATTGTTTTGATCTCGTTGGTTCAGCATTCCTATGGCACCAAGTTCGTTGCATGATGGCC ATTCTTTTCTTAGTTGGTCAATCACTTGAAGTGCCGGAAATTGTCTTGCGTCTGACTGAT ATTGAGAAAACCCCTCAAAGGCCTGTTTACGAAATGGCAAATGATATACCATTATTGTTA TATGATTGTAAATTTCCTGAAATGGATTGGCAAGAACCTACTGTAGATGACTATAAGGCA ATAAAATTCACGACAGCTACTGAAGCATTGACGTTACACTACGAACTTAAGGCCGCAGTA TGCAATATTTTTAAAGATGTTTTGCCCACAGCAAATACAAACAACTTCTCAAAGACAATT ATTAATTTGGGCGATGGAAGAGGTAAAGTAGTCGGTACCTATGTGAAACTAGAGGATAGA AGCGTTATGGAACCTGTCGAAGTTGTTAATGCTAAATACTCCAAGAAAAAGAACAACAAA AATAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues442
Protein Molecular Weight50888.30078
Protein Theoretical pI9.75
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA pseudouridine synthase 3 MSNFIRRLVGKMKAISTGTNAIVSKKDSIYANWSKEQLIRRITELENANKPHSEKFQHIE DNKKRKISQEEVTRSKAKKAPKKFDFSKHNTRFIALRFAYLGWNYNGLAVQKEYTPLPTV EGTILEAMNKCKLVPSMVLQDYKFSRCGRTDKGVSAMNQVISLEVRSNLTDEEQRDPTND SREIPYVHVLNQLLPDDIRISAVCLRPPPNFDARFSCVHRHYKYIFNGKNLNIEKMSKAA SYFVGERDFRNFCKLDGSKQITNFKRTIISSKILPLSETFYCFDLVGSAFLWHQVRCMMA ILFLVGQSLEVPEIVLRLTDIEKTPQRPVYEMANDIPLLLYDCKFPEMDWQEPTVDDYKA IKFTTATEALTLHYELKAAVCNIFKDVLPTANTNNFSKTIINLGDGRGKVVGTYVKLEDR SVMEPVEVVNAKYSKKKNNKNK
References
External Links
ResourceLink
Saccharomyces Genome Database PUS3
Uniprot IDP31115
Uniprot NamePUS3_YEAST
GenBank Gene IDAY693197
Genebank Protein ID51013845
General Reference
  • Carbone, M. L., Solinas, M., Sora, S., Panzeri, L. (1991). "A gene tightly linked to CEN6 is important for growth of Saccharomyces cerevisiae." Curr Genet 19:1-8.2036682
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Naitou, M., Ozawa, M., Sasanuma, S. I., Kobayashi, M., Hagiwara, H., Shibata, T., Hanaoka, F., Watanabe, K., Ono, A., Yamazaki, M., Tashiro, H., Eki, T., Murakami, Y. (1996). "Sequencing of a 23 kb fragment from Saccharomyces cerevisiae chromosome VI." Yeast 12:77-84.8789262
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Lecointe, F., Simos, G., Sauer, A., Hurt, E. C., Motorin, Y., Grosjean, H. (1998). "Characterization of yeast protein Deg1 as pseudouridine synthase (Pus3) catalyzing the formation of psi 38 and psi 39 in tRNA anticodon loop." J Biol Chem 273:1316-1323.9430663
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956