You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMannose-6-phosphate isomerase
Synonyms
  • Phosphohexomutase
  • Phosphomannose isomerase
  • PMI
Gene NamePMI40
Enzyme Class
Biological Properties
General FunctionInvolved in mannose-6-phosphate isomerase activity
Specific FunctionInvolved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Mannose MetabolismPW002391 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
Mannose 6-phosphateBeta-D-Fructose 6-phosphate
KEGG Reactions
D-mannose 6-phosphateFructose 6-phosphate
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00242Mannose 6-phosphateShow
YMDB00966D-mannose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
zinc ion binding
isomerase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
mannose-6-phosphate isomerase activity
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER003C
Gene Sequence>1290 bp ATGTCCAACAAGCTGTTCAGGTTAGATGCAGGCTACCAACAATACGACTGGGGTAAAATC GGCTCTTCTTCACGTGTCGCTCAATTTGCTGCCCATTCTGACCCCTCTGTTCAAATTGAA CAAGATAAACCATATGCAGAGTTATGGATGGGTACCCACAGCAAGATGCCTTCCTACAAC CATGAGTCTAAGGAATCCCTGAGAGATATCATCTCCAAGAACCCCTCTGCCATGTTAGGT AAGGACATTATTGATAAGTTCCACGCCACAAATGAATTGCCCTTCCTTTTCAAAGTTTTG TCCATTGAAAAAGTCTTGTCTATTCAAGCACATCCCGACAAAGCCTTGGGTAAAATATTG CACGCTCAAGATCCTAAGAACTATCCTGATGATAATCACAAACCTGAAATGGCCATCGCT GTGACTGACTTTGAAGGTTTCTGCGGGTTCAAACCTTTGCAAGAGATTGCAGATGAATTG AAACGTATTCCTGAATTACGCAACATTGTTGGTGAAGAAACTTCCAGGAATTTTATTGAG AACATTCAACCTTCTGCTCAGAAAGGTTCCCCAGAAGATGAGCAAAACAAAAAGCTATTG CAAGCTGTTTTCAGCAGGGTCATGAACGCTTCGGATGACAAAATCAAGATTCAAGCTCGC TCCTTGGTCGAAAGATCAAAGAATTCTCCATCAGACTTTAACAAACCTGATTTACCAGAA TTAATTCAAAGACTGAATAAACAGTTCCCTGATGACGTGGGTTTGTTTTGTGGATGTTTA TTGTTGAATCACTGCAGATTGAATGCTGGTGAAGCCATCTTTTTAAGAGCTAAGGATCCT CACGCCTATATAAGCGGTGATATTATGGAATGTATGGCTGCTTCTGACAACGTAGTTAGA GCAGGCTTCACTCCAAAATTCAAGGATGTTAAAAACTTGGTCTCCATGTTAACCTATACA TATGATCCTGTGGAAAAGCAAAAAATGCAGCCTTTAAAGTTCGACAGGTCCTCTGGTAAC GGTAAGTCAGTTTTATATAACCCTCCAATCGAAGAATTTGCTGTATTGGAGACTACTTTT GATGAGAAACTTGGTCAAAGGCATTTTGAAGGTGTTGATGGTCCAAGTATCTTAATCACT ACAAAAGGTAATGGTTACATTAAAGCAGATGGCCAAAAATTGAAAGCTGAACCCGGTTTT GTCTTTTTCATCGCTCCACATTTGCCTGTTGATTTGGAAGCTGAAGATGAGGCGTTTACT ACCTATAGAGCCTTTGTGGAACCAAATTAG
Protein Properties
Pfam Domain Function
Protein Residues429
Protein Molecular Weight48188.30078
Protein Theoretical pI5.83
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mannose-6-phosphate isomerase MSNKLFRLDAGYQQYDWGKIGSSSAVAQFAAHSDPSVQIEQDKPYAELWMGTHSKMPSYN HESKESLRDIISKNPSAMLGKDIIDKFHATNELPFLFKVLSIEKVLSIQAHPDKALGKIL HAQDPKNYPDDNHKPEMAIAVTDFEGFCGFKPLQEIADELKRIPELRNIVGEETSRNFIE NIQPSAQKGSPEDEQNKKLLQAVFSRVMNASDDKIKIQARSLVERSKNSPSDFNKPDLPE LIQRLNKQFPDDVGLFCGCLLLNHCRLNAGEAIFLRAKDPHAYISGDIMECMAASDNVVR AGFTPKFKDVKNLVSMLTYTYDPVEKQKMQPLKFDRSSGNGKSVLYNPPIEEFAVLETTF DEKLGQRHFEGVDGPSILITTKGNGYIKADGQKLKAEPGFVFFIAPHLPVDLEAEDEAFT TYRAFVEPN
References
External Links
ResourceLink
Saccharomyces Genome Database PMI40
Uniprot IDP29952
Uniprot NameMPI_YEAST
GenBank Gene IDM85238
Genebank Protein ID172166
General Reference
  • Smith, D. J., Proudfoot, A., Friedli, L., Klig, L. S., Paravicini, G., Payton, M. A. (1992). "PMI40, an intron-containing gene required for early steps in yeast mannosylation." Mol Cell Biol 12:2924-2930.1377774
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Wells, T. N., Coulin, F., Payton, M. A., Proudfoot, A. E. (1993). "Phosphomannose isomerase from Saccharomyces cerevisiae contains two inhibitory metal ion binding sites." Biochemistry 32:1294-1301.8448139
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956