You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMannose-6-phosphate isomerase
Synonyms
  • Phosphohexomutase
  • Phosphomannose isomerase
  • PMI
Gene NamePMI40
Enzyme Class
Biological Properties
General FunctionInvolved in mannose-6-phosphate isomerase activity
Specific FunctionInvolved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Mannose MetabolismPW002391 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
Mannose 6-phosphateBeta-D-Fructose 6-phosphate
KEGG Reactions
D-mannose 6-phosphateFructose 6-phosphate
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00242Mannose 6-phosphateShow
YMDB00966D-mannose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
Not Available
Function
zinc ion binding
isomerase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
mannose-6-phosphate isomerase activity
catalytic activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER003C
Gene Sequence>1290 bp ATGTCCAACAAGCTGTTCAGGTTAGATGCAGGCTACCAACAATACGACTGGGGTAAAATC GGCTCTTCTTCACGTGTCGCTCAATTTGCTGCCCATTCTGACCCCTCTGTTCAAATTGAA CAAGATAAACCATATGCAGAGTTATGGATGGGTACCCACAGCAAGATGCCTTCCTACAAC CATGAGTCTAAGGAATCCCTGAGAGATATCATCTCCAAGAACCCCTCTGCCATGTTAGGT AAGGACATTATTGATAAGTTCCACGCCACAAATGAATTGCCCTTCCTTTTCAAAGTTTTG TCCATTGAAAAAGTCTTGTCTATTCAAGCACATCCCGACAAAGCCTTGGGTAAAATATTG CACGCTCAAGATCCTAAGAACTATCCTGATGATAATCACAAACCTGAAATGGCCATCGCT GTGACTGACTTTGAAGGTTTCTGCGGGTTCAAACCTTTGCAAGAGATTGCAGATGAATTG AAACGTATTCCTGAATTACGCAACATTGTTGGTGAAGAAACTTCCAGGAATTTTATTGAG AACATTCAACCTTCTGCTCAGAAAGGTTCCCCAGAAGATGAGCAAAACAAAAAGCTATTG CAAGCTGTTTTCAGCAGGGTCATGAACGCTTCGGATGACAAAATCAAGATTCAAGCTCGC TCCTTGGTCGAAAGATCAAAGAATTCTCCATCAGACTTTAACAAACCTGATTTACCAGAA TTAATTCAAAGACTGAATAAACAGTTCCCTGATGACGTGGGTTTGTTTTGTGGATGTTTA TTGTTGAATCACTGCAGATTGAATGCTGGTGAAGCCATCTTTTTAAGAGCTAAGGATCCT CACGCCTATATAAGCGGTGATATTATGGAATGTATGGCTGCTTCTGACAACGTAGTTAGA GCAGGCTTCACTCCAAAATTCAAGGATGTTAAAAACTTGGTCTCCATGTTAACCTATACA TATGATCCTGTGGAAAAGCAAAAAATGCAGCCTTTAAAGTTCGACAGGTCCTCTGGTAAC GGTAAGTCAGTTTTATATAACCCTCCAATCGAAGAATTTGCTGTATTGGAGACTACTTTT GATGAGAAACTTGGTCAAAGGCATTTTGAAGGTGTTGATGGTCCAAGTATCTTAATCACT ACAAAAGGTAATGGTTACATTAAAGCAGATGGCCAAAAATTGAAAGCTGAACCCGGTTTT GTCTTTTTCATCGCTCCACATTTGCCTGTTGATTTGGAAGCTGAAGATGAGGCGTTTACT ACCTATAGAGCCTTTGTGGAACCAAATTAG
Protein Properties
Pfam Domain Function
Protein Residues429
Protein Molecular Weight48188.30078
Protein Theoretical pI5.83
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mannose-6-phosphate isomerase MSNKLFRLDAGYQQYDWGKIGSSSAVAQFAAHSDPSVQIEQDKPYAELWMGTHSKMPSYN HESKESLRDIISKNPSAMLGKDIIDKFHATNELPFLFKVLSIEKVLSIQAHPDKALGKIL HAQDPKNYPDDNHKPEMAIAVTDFEGFCGFKPLQEIADELKRIPELRNIVGEETSRNFIE NIQPSAQKGSPEDEQNKKLLQAVFSRVMNASDDKIKIQARSLVERSKNSPSDFNKPDLPE LIQRLNKQFPDDVGLFCGCLLLNHCRLNAGEAIFLRAKDPHAYISGDIMECMAASDNVVR AGFTPKFKDVKNLVSMLTYTYDPVEKQKMQPLKFDRSSGNGKSVLYNPPIEEFAVLETTF DEKLGQRHFEGVDGPSILITTKGNGYIKADGQKLKAEPGFVFFIAPHLPVDLEAEDEAFT TYRAFVEPN
References
External Links
ResourceLink
Saccharomyces Genome Database PMI40
Uniprot IDP29952
Uniprot NameMPI_YEAST
GenBank Gene IDM85238
Genebank Protein ID172166
General Reference
  • Smith, D. J., Proudfoot, A., Friedli, L., Klig, L. S., Paravicini, G., Payton, M. A. (1992). "PMI40, an intron-containing gene required for early steps in yeast mannosylation." Mol Cell Biol 12:2924-2930.1377774
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Wells, T. N., Coulin, F., Payton, M. A., Proudfoot, A. E. (1993). "Phosphomannose isomerase from Saccharomyces cerevisiae contains two inhibitory metal ion binding sites." Biochemistry 32:1294-1301.8448139
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956