You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenylate kinase 2
Synonyms
  • AK 2
  • ATP-AMP transphosphorylase 2
Gene NameADK2
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionThis small ubiquitous enzyme is essential for maintenance and cell growth
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine monophosphate + Adenosine triphosphateADP
Adenosine monophosphate + GTPADP + Guanosine diphosphate
Adenosine monophosphate + ITPIDP + ADP
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00257Guanosine diphosphateShow
YMDB00558GTPShow
YMDB00559ITPShow
YMDB00910IDPShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
kinase activity
nucleotide kinase activity
phosphotransferase activity, phosphate group as acceptor
nucleobase, nucleoside, nucleotide kinase activity
adenylate kinase activity
binding
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
transferase activity
adenyl ribonucleotide binding
ATP binding
transferase activity, transferring phosphorus-containing groups
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER170W
Gene Sequence>678 bp ATGAAAGCAGACGCGAAACAAATAACACATCTACTCAAACCTCTTCGACTTTTATTATTG GGGGCTCCAGGGTCAGGTAAAGGGACACAGACTTCGAGATTACTAAAGCAAATTCCACAA TTATCTTCAATTTCGTCAGGCGACATTTTACGTCAGGAAATAAAATCTGAATCTACCCTA GGCCGAGAGGCTACTACCTACATTGCTCAAGGCAAGTTATTACCGGATGATCTCATAACG CGTCTGATAACTTTTCGTCTTTCGGCATTGGGTTGGTTAAAACCATCTGCCATGTGGTTG CTCGATGGATTTCCTCGAACTACTGCGCAAGCTTCTGCCTTAGACGAGCTGCTGAAACAG CATGACGCCAGCTTGAATCTAGTGGTAGAGCTAGATGTACCCGAATCCACCATATTAGAA AGGATCGAGAACAGATATGTTCACGTTCCTAGTGGGAGAGTGTATAACTTACAATATAAT CCTCCCAAAGTGCCAGGATTAGACGATATCACCGGAGAACCATTGACCAAGAGGCTTGAT GACACAGCGGAAGTGTTTAAAAAAAGGCTAGAAGAGTACAAGAAAACAAATGAGCCTTTA AAAGATTATTACAAAAAAAGTGGGATTTTTGGTACCGTCTCTGGGGAAACATCAGATATT ATCTTCCGAAATTATTGA
Protein Properties
Pfam Domain Function
Protein Residues225
Protein Molecular Weight25193.69922
Protein Theoretical pI9.42
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenylate kinase 2 MKADAKQITHLLKPLRLLLLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTL GREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQ HDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLD DTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIFRNY
References
External Links
ResourceLink
Saccharomyces Genome Database ADK2
Uniprot IDP26364
Uniprot NameKAD2_YEAST
GenBank Gene IDAY558457
Genebank Protein ID45270804
General Reference
  • Cooper, A. J., Friedberg, E. C. (1992). "A putative second adenylate kinase-encoding gene from the yeast Saccharomyces cerevisiae." Gene 114:145-148.1587477
  • Schricker, R., Magdolen, V., Bandlow, W. (1992). "A new member of the adenylate kinase family in yeast: PAK3 is highly homologous to mammalian AK3 and is targeted to mitochondria." Mol Gen Genet 233:363-371.1620094
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106