You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAutophagy-related protein 22
SynonymsNot Available
Gene NameATG22
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in amino acid export from vacuole
Specific FunctionRequired for lysis of autophagic vesicles after delivery to the vacuole
Cellular LocationVacuole membrane; Multi-pass membrane protein.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00364L-TyrosineShow
YMDB00387L-LeucineShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 3
LocusYCL038C
Gene Sequence>1587 bp ATGAGCTATGGAACTATAAATGATATGAATGAATCGGTAACGAACTATCGAATAAAAAAA GCCCAAAACAATATCAAGGGATGGTACGCTTACTCATTTTCTAGCGAACCATTTGTCGTT TCTGCGGTTTCAACGTATATTCCCTTACTACTGCAGCAATTTGCGAGTATAAATGGTGTA AAAGTTCACGATCACTCCATACCCTGCCTGTCAGAAACGGGTAGTGATTCAGATAAGTGT GTTCTTGGTTTGTTCAACAATCGGATCTTCGTAGATACTTCAAGTTTTGCATTATATGTC TTTTCCCTTAGCGTTTTATTCCAAACTATAATAGTCATTTCCGTTTCAGGGATAGTAGAT CTCTGGGGGAGCGTTAAATTCAAAGGCAGAATTCTGGTTTGGTTTGGTATTGTGGGCGCA TTGTCGACTGTTGCGATTTCAAAATTGAATGATACCCAGATTTATTCTCTGGCTGGGCTT TATATAGTGGCCAATGGTTGTTTTGGCGTTATCAATGTTGTTGGGAATTCTCTTCTGCCC ATTTTTGTCAAGGATTCTTTGAAATGTCAAAGTCAAGGAGCTTATGAACCTGATAAGGTA GACTCGTTAACTACTGTTATTAGCGGTAGAGGTGCATCTTTAGGTTATTCAAGTGCCCTC ATTGTTCAGATTGTATCTATGTTCTTAGTCGCATCTAAAAAGGGCAGTAAGCAGGATGTT CAAGTGGCTGTTCTTTTCGTTGGGATTTGGTGGTTTGTGTGGCAACTGCCCATGATCTGG TTGATTGACGATGTGACAATACCGATAAGAGTTGACGATTCTACATTAGCATCCGCCCGC AGTCCGTATCCCGGTGAGCAAGACGCCTTGGGTCAACTAAACTGGAAGAATTACCTTTCA TATGGTTGGGTTTCGCTTTTCGAATCGTTTAAACATGCCAGACTATTGAAAGATGTGATG ATTTTTCTTATTGCGTGGTTTATTATTAGTGATTCCATTACAACTATAAATTCTACAGCG GTTTTGTTCTCCAAGGCAGAACTGCACATGAGTACCCTCAATTTAATCATGATAAGTGTT TTGACCGTTGTAAATGCAATGCTGGGTGCCTTTATGATTCCACAATTTCTTGCCACAAAG TTTCGGTGGACTTCTAGTCAAACTTTGATGTACATTATCATTTGGGCAAGTTTCATACCA TTTTATGGTATTCTTGGATTTTTCTTCAATGCGTTCGGTTTAAAGCATAAGTTTGAAATG TTCTTATTGGCCATTTGGTATGGATTATCACTAGGTGGCCTGTCCGCGGTTTCAAGATCA GTTTTCAGTTTGATTGTACCTCCAGGAAAAGAATCCACGTTTTTTAGTATGTTCAGTATC ACAGATAAGGGGTCGTCCATCCTGGGACCCTTCCTTGTTGGACTGCTTACCGATAAAACG CATAATATTCGCTATTCGTTTTATTTCTTCTTTTTGCTTTTGATGCTATCATTGCCTGTG CTAAACTGTTTGGATGTCAAGAGAGGTAGAAGAGAGGCTGAAGAACTCAGTCAAGTTTTA CCTGAAAGTGAAAGAAGGTTGGATTAG
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues528
Protein Molecular Weight58843.10156
Protein Theoretical pI8.61
Signalling Regions
  • None
Transmembrane Regions
  • 99-119
  • 131-151
  • 154-174
  • 211-231
  • 242-262
  • 319-339
  • 353-373
  • 389-409
  • 418-438
  • 486-506
Protein Sequence>Autophagy-related protein 22 MSYGTINDMNESVTNYRIKKAQNNIKGWYAYSFSSEPFVVSAVSTYIPLLLQQFASINGV KVHDHSIPCLSETGSDSDKCVLGLFNNRIFVDTSSFALYVFSLSVLFQTIIVISVSGIVD LWGSVKFKGRILVWFGIVGALSTVAISKLNDTQIYSLAGLYIVANGCFGVINVVGNSLLP IFVKDSLKCQSQGAYEPDKVDSLTTVISGRGASLGYSSALIVQIVSMFLVASKKGSKQDV QVAVLFVGIWWFVWQLPMIWLIDDVTIPIRVDDSTLASARSPYPGEQDALGQLNWKNYLS YGWVSLFESFKHARLLKDVMIFLIAWFIISDSITTINSTAVLFSKAELHMSTLNLIMISV LTVVNAMLGAFMIPQFLATKFRWTSSQTLMYIIIWASFIPFYGILGFFFNAFGLKHKFEM FLLAIWYGLSLGGLSAVSRSVFSLIVPPGKESTFFSMFSITDKGSSILGPFLVGLLTDKT HNIRYSFYFFFLLLMLSLPVLNCLDVKRGRREAEELSQVLPESERRLD
References
External Links
ResourceLink
Saccharomyces Genome Database ATG22
Uniprot IDP25568
Uniprot NameATG22_YEAST
GenBank Gene IDX59720
Genebank Protein ID5325
General Reference
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Harding, T. M., Hefner-Gravink, A., Thumm, M., Klionsky, D. J. (1996). "Genetic and phenotypic overlap between autophagy and the cytoplasm to vacuole protein targeting pathway." J Biol Chem 271:17621-17624.8663607
  • Suriapranata, I., Epple, U. D., Bernreuther, D., Bredschneider, M., Sovarasteanu, K., Thumm, M. (2000). "The breakdown of autophagic vesicles inside the vacuole depends on Aut4p." J Cell Sci 113 ( Pt 22):4025-4033.11058089
  • Klionsky, D. J., Cregg, J. M., Dunn, W. A. Jr, Emr, S. D., Sakai, Y., Sandoval, I. V., Sibirny, A., Subramani, S., Thumm, M., Veenhuis, M., Ohsumi, Y. (2003). "A unified nomenclature for yeast autophagy-related genes." Dev Cell 5:539-545.14536056
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956