You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUncharacterized protein YCL033C
SynonymsNot Available
Gene NameNot Available
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in peptide-methionine-(S)-S-oxide reductase activity
Specific FunctionNot Available
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00318L-MethionineShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
peptide-methionine-(S)-S-oxide reductase activity
catalytic activity
oxidoreductase activity
oxidoreductase activity, acting on a sulfur group of donors
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>507 bp ATGAATAAGTGGAGCAGGCTGTACGTTATAACTGTACGCAGGACTTTTCCAGGGAGAAGA AACATTGTACTGACGCAGTACTGGAATAAGAGCAAGAAAATGAGTGACGAATCGAATGAC GTGAAGTGGAACGATGCCCTGACACCATTGCAGCTGATGGTGCTGAGAGATAAGGCCACT GAAAGGCCCAACACCGGTGCGTATTTACACACCAACGAGTCCGGTGTCTACCATTGTGCC AACTGCGACAGACCGTTGTATTCGAGCAAGGCCAAGTTCGACGCTCGTTGTGGATGGCCC GCATTCTACGAAGAGGTATCCCCTGGAGCCATCACATATCATCGTGACAATTCTTTAATG CCTGCGAGGGTGGAGATATGTTGTGCAAGGTGTGGTGGACACTTGGGACATGTGTTTGAA GGTGAAGGCTGGAAACAGTTGCTAAACTTGCCCAAGGACACCAGACACTGTGTGAACAGT GCGTCTTTAAACCTCAAGAAGGATTAA
Protein Properties
Pfam Domain Function
Protein Residues168
Protein Molecular Weight19278.80078
Protein Theoretical pI9.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uncharacterized protein YCL033C MNKWSRLYVITVRRTFPGRRNIVLTQYWNKSKKMSDESNDVKWNDALTPLQLMVLRDKAT ERPNTGAYLHTNESGVYHCANCDRPLYSSKAKFDARCGWPAFYEEVSPGAITYHRDNSLM PARVEICCARCGGHLGHVFEGEGWKQLLNLPKDTRHCVNSASLNLKKD
References
External Links
ResourceLink
Uniprot IDP25566
Uniprot NameYCD3_YEAST
GenBank Gene IDX59720
Genebank Protein ID5331
General Reference
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106