You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCysteine desulfurase, mitochondrial
Synonyms
  • tRNA-splicing protein SPL1
Gene NameNFS1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionCatalyzes the removal of elemental sulfur from cysteine to produce alanine. It supplies the inorganic sulfur for iron- sulfur (Fe-S) clusters. Involved in both tRNA-processing and mitochondrial metabolism
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Thiamine metabolismec00730 Map00730
SMPDB Reactions
L-Cysteine + an [L-cysteine desulfurase] L-cysteine persulfide → an [L-cysteine desulfurase] L-cysteine persulfide + L-Alanine
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00154L-AlanineShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
transferase activity, transferring sulfur-containing groups
sulfurtransferase activity
cysteine desulfurase activity
catalytic activity
transferase activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
sulfur amino acid metabolic process
cysteine metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCL017C
Gene Sequence>1494 bp ATGTTGAAATCAACTGCTACAAGATCGATAACAAGATTATCTCAAGTTTACAACGTTCCA GCGGCCACATATAGGGCTTGTTTGGTAAGCAGGAGATTCTATTCCCCTCCTGCAGCAGGC GTGAAGTTAGACGACAACTTCTCTCTGGAAACGCATACCGATATTCAGGCTGCTGCAAAG GCACAGGCTAGTGCCCGTGCGAGTGCATCCGGTACCACCCCAGATGCTGTAGTAGCTTCT GGTAGCACTGCAATGAGCCATGCTTATCAAGAAAACACAGGTTTTGGTACTCGTCCCATA TATCTTGACATGCAAGCCACTACACCAACAGACCCTAGGGTTTTGGATACGATGTTGAAG TTTTATACGGGACTTTATGGTAATCCTCATTCCAACACTCACTCTTACGGTTGGGAAACA AATACTGCTGTGGAAAATGCTAGAGCTTACGTAGCAAAGATGATCAATGCCGACCCCAAG GAAATAATATTCACTTCGGGAGCGACCGAATCTAATAATATGGTTCTTAAGGGTGTCCCA AGATTTTATAAGAAGACTAAGAAACACATCATCACCACTAGAACGGAACACAAGTGTGTC TTGGAAGCCGCACGGGCCATGATGAAGGAGGGATTTGAAGTCACTTTCCTAAATGTGGAC GATCAAGGTCTTATCGATTTGAAGGAATTGGAAGATGCCATTAGACCAGATACCTGTCTC GTCTCTGTGATGGCTGTCAATAATGAAATCGGTGTCATTCAACCTATTAAAGAAATTGGT GCAATTTGTAGAAAGAATAAGATCTACTTTCATACTGACGCCGCACAAGCCTATGGTAAG ATTCACATTGATGTCAATGAAATGAACATTGATTTACTATCAATTTCTTCTCACAAGATT TACGGTCCAAAGGGAATAGGTGCCATCTATGTAAGAAGGAGACCAAGAGTTAGATTAGAA CCTTTACTATCCGGTGGTGGCCAAGAGAGAGGATTGAGATCTGGTACTTTGGCCCCCCCA TTGGTAGCGGGATTTGGTGAAGCTGCGAGATTGATGAAGAAAGAATTTGACAACGACCAA GCTCACATCAAAAGACTATCCGATAAATTAGTCAAAGGTCTATTATCCGCTGAACATACC ACGTTGAACGGATCTCCAGATCATCGTTATCCAGGGTGTGTTAACGTTTCTTTCGCCTAC GTGGAAGGAGAATCTTTATTGATGGCACTAAGGGATATCGCATTATCCTCGGGTTCAGCC TGTACATCTGCTTCCCTAGAACCTTCTTATGTTTTACATGCGCTGGGTAAGGATGATGCA TTAGCCCATTCTTCCATCAGATTTGGTATTGGTAGATTTAGTACTGAAGAGGAGGTCGAC TACGTCGTTAAGGCCGTTTCTGACAGAGTAAAATTCTTGAGGGAACTTTCACCATTATGG GAAATGGTTCAAGAAGGTATTGACTTAAACTCCATCAAATGGTCAGGTCATTGA
Protein Properties
Pfam Domain Function
Protein Residues497
Protein Molecular Weight54466.5
Protein Theoretical pI8.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cysteine desulfurase, mitochondrial MLKSTATRSITRLSQVYNVPAATYRACLVSRRFYSPPAAGVKLDDNFSLETHTDIQAAAK AQASARASASGTTPDAVVASGSTAMSHAYQENTGFGTRPIYLDMQATTPTDPRVLDTMLK FYTGLYGNPHSNTHSYGWETNTAVENARAHVAKMINADPKEIIFTSGATESNNMVLKGVP RFYKKTKKHIITTRTEHKCVLEAARAMMKEGFEVTFLNVDDQGLIDLKELEDAIRPDTCL VSVMAVNNEIGVIQPIKEIGAICRKNKIYFHTDAAQAYGKIHIDVNEMNIDLLSISSHKI YGPKGIGAIYVRRRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGEAARLMKKEFDNDQ AHIKRLSDKLVKGLLSAEHTTLNGSPDHRYPGCVNVSFAYVEGESLLMALRDIALSSGSA CTSASLEPSYVLHALGKDDALAHSSIRFGIGRFSTEEEVDYVVKAVSDRVKFLRELSPLW EMVQEGIDLNSIKWSGH
References
External Links
ResourceLink
Saccharomyces Genome Database NFS1
Uniprot IDP25374
Uniprot NameNFS1_YEAST
GenBank Gene IDM98808
Genebank Protein ID172038
General Reference
  • Kolman, C., Soll, D. (1993). "SPL1-1, a Saccharomyces cerevisiae mutation affecting tRNA splicing." J Bacteriol 175:1433-1442.8444805
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Froman, B. E., Tait, R. C., Rodriguez, R. L. (1984). "Nucleotide sequence of the 3' terminal region of the LEU2 gene from Saccharomyces cerevisiae." Gene 31:257-261.6396161
  • Kispal, G., Csere, P., Prohl, C., Lill, R. (1999). "The mitochondrial proteins Atm1p and Nfs1p are essential for biogenesis of cytosolic Fe/S proteins." EMBO J 18:3981-3989.10406803
  • Li, J., Kogan, M., Knight, S. A., Pain, D., Dancis, A. (1999). "Yeast mitochondrial protein, Nfs1p, coordinately regulates iron-sulfur cluster proteins, cellular iron uptake, and iron distribution." J Biol Chem 274:33025-33034.10551871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106