You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCasein kinase I homolog 1
SynonymsNot Available
Gene NameYCK1
Enzyme ClassNot Available
Biological Properties
General Functionresponse to glucose
Specific FunctionCasein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.
Cellular LocationNot Available
SMPDB Pathways
Stress-activated signalling pathways: pheromone stress test 1PW012843 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
ATP binding
nucleus
protein serine/threonine kinase activity
peptidyl-serine phosphorylation
protein phosphorylation
plasma membrane
regulation of cell shape
cell morphogenesis
endocytosis
response to glucose
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1617 bp ATGTCCATGCCCATAGCAAGTACCACTCTAGCAGTTAACAACCTCACCAATATAAACGGA AACGCAAATTTTAACGTACAAGCAAACAAACAACTCCACCACCAGGCTGTCGACTCGCCC GCAAGATCTTCGATGACCGCCACGACCGCCGCCAACTCCAACAGCAACTCTTCCAGAGAT GACTCTACTATTGTCGGCCTACATTACAAGATCGGCAAAAAAATAGGGGAAGGTTCCTTT GGTGTGCTATTTGAAGGTACTAATATGATCAATGGCGTACCCGTCGCGATCAAATTCGAG CCCAGAAAAACGGAGGCCCCTCAATTAAGAGATGAATATAAAACATATAAAATTCTGAAT GGCACTCCCAATATCCCCTACGCGTACTACTTCGGCCAAGAAGGTTTGCACAATATCTTG GTCATTGATCTTTTGGGTCCCTCTTTGGAAGATTTATTTGATTGGTGTGGAAGAAAATTT TCTGTCAAAACGGTTGTGCAAGTTGCTGTCCAAATGATTACTTTGATTGAAGACTTGCAC GCACATGACTTGATATACCGTGATATCAAACCAGACAATTTCTTGATTGGAAGGCCCGGC CAACCTGACGCAAACAACATCCATTTGATCGACTTCGGTATGGCCAAACAGTATCGTGAT CCGAAAACTAAACAGCACATCCCATATAGAGAGAAAAAATCACTCAGCGGCACTGCCAGA TATATGTCCATTAATACTCACCTTGGAAGAGAGCAGTCCAGAAGAGATGATATGGAGGCC TTGGGTCACGTTTTCTTTTATTTCTTGAGAGGCCACTTACCCTGGCAGGGTTTAAAAGCT CCAAACAATAAGCAAAAATACGAAAAGATTGGTGAAAAGAAAAGATCTACTAACGTTTAC GATCTAGCTCAAGGCTTACCTGTGCAATTTGGCAGGTATCTAGAAATCGTCAGAAGTCTT TCCTTTGAAGAGTGTCCCGATTATGAAGGCTATAGAAAACTATTACTATCTGTACTGGAT GATTTAGGTGAAACCGCGGACGGCCAATATGATTGGATGAAACTGAACGATGGCCGTGGT TGGGATCTTAACATAAACAAGAAGCCAAATCTCCACGGATACGGCCATCCAAATCCACCA AACGAAAAATCGAGAAAACATAGAAACAAACAGCTCCAAATGCAACAGCTCCAAATGCAA CAGCTCCAACAACAGCAACAGCAACAGCAATATGCTCAAAAAACTGAGGCAGATATGCGC AATTCTCAATATAAACCAAAGTTAGACCCTACTTCTTATGAAGCTTACCAGCATCAAACC CAGCAGAAATACCTGCAAGAACAACAAAAGAGACAGCAGCAACAAAAACTTCAGGAGCAA CAACTTCAAGAGCAACAATTGCAACAGCAGCAACAGCAACAGCAACAGCTACGTGCAACA GGCCAACCTCCATCTCAGCCTCAAGCGCAAACTCAATCTCAGCAGTTTGGCGCTCGTTAT CAACCACAACAACAACCTTCTGCTGCTTTAAGAACTCCTGAACAGCACCCAAATGACGAT AATTCAAGTCTAGCTGCTTCTCATAAGGGCTTTTTCCAAAAATTAGGTTGTTGCTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues538
Protein Molecular Weight61715.025
Protein Theoretical pINot Available
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Casein kinase I homolog 1 MSMPIASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPARSSMTATTAANSNSNSSRD DSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILN GTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLH AHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR YMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVY DLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRG WDLNINKKPNLHGYGHPNPPNEKSRKHRNKQLQMQQLQMQQLQQQQQQQQYAQKTEADMR NSQYKPKLDPTSYEAYQHQTQQKYLQEQQKRQQQQKLQEQQLQEQQLQQQQQQQQQLRAT GQPPSQPQAQTQSQQFGARYQPQQQPSAALRTPEQHPNDDNSSLAASHKGFFQKLGCC
References
External Links
ResourceLink
Saccharomyces Genome Database YCK1
Uniprot IDP23291
Uniprot NameYCK1
General ReferenceNot Available