You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable amidase
SynonymsNot Available
Gene NameAMD2
Enzyme Class
Biological Properties
General FunctionInvolved in carbon-nitrogen ligase activity, with glutamine as amido-N-donor
Specific FunctionA monocarboxylic acid amide + H(2)O = a monocarboxylate + NH(3)
Cellular LocationNot Available
SMPDB Pathways
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Cyanoamino acid metabolismec00460 Map00460
Phenylalanine metabolismec00360 Map00360
Tryptophan metabolismec00380 Map00380
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
GO Classification
Component
Not Available
Function
carbon-nitrogen ligase activity, with glutamine as amido-N-donor
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR242W
Gene Sequence>1650 bp ATGACTGTGCACTCAACGTGGAAGGAAAAAGTTCAATTAAAAAAAGATCAACTGAACAGT AAGATAAAAGACGAATGGAAATTAAACAGCACAACTATAACGAGGTTGAAGAACGATAAA AAAAATTTAATCAAGAATATCGATGATTTATGCTCATCTTCAGAAAATCAGATCACCCAC TCCACGATTATGGCCTTGAGACAGGCACTGGAAGCAAAAGAGTTAAGCTGCCATGAAATA ACAGCTGCATTTTGTCATAGGGCTGCTTTAATTCATCAAGTAGTGAATTGTCTATCCGAA ATCATGTTTTCAGAGGCATTGAGATTGGCTGACTATTACGACAGCAATAGACCAGCCATA TTGCCACCCTTGTACGGTATACCGATATCTCTCAAAGACCAATGTAACGTTGAGGGTGTA GACACCTCACTGGGTTATTTATGTCGAACTTTCAAACCAAAAACCAAGAATGAAGAATCA TTGATTGTCAGTTTTCTGAGAGATTTAGGAGCTATTATATTTGTAAAAACCACCGTACCT TCATCGATGATGGCTACAGATACACAATCTAACACCTTTGGGTACACATATAATAGTATT AATTTAAGCTTCTCCAGTGGTGGATCTTCTGGTGGAGAGGGTTCGTTAATTGGTGCTCAT GGTTCCTTGCTGGGACTAGGAACTGATATAGGCGGAAGCATCAGAATTCCTAGTAGTTAC CAAGGATTATTTGGTTTGAAACCAACTTTTGGACGCGTCCCTTACTTGAGGGTGGATAAT TCATTTGAGGGAAGGGAAACAATTCCCAGTGTAATTGGGCCGTTGGCAAGAGATCTTTCG GATTTGAGATACTTCATGAGTTGCGTTATCAACATCTGTCAACCATGGGTACAAGACGTC AAGTGTATTCCATACCATTTTGATTCCTCTACAAGTAAATTACACGATAATTATGTTGTT GGAATATGGTATGGTGACGGCGTTATTGATCCTCCGCCCAGTGACATCAGGGCTTTAAAG ACGTGCGAAGACCTAGTCAATAAAACTAAAGGAATGAAGGCAGTTAAATGGGAGCCTTCC AGTGAACTGAGCAGGGAATTGTTTGATCTCGCAAATGAAGCAGATGTTGCTGACTCAGGT AACGAGATAAAAAACGAATTCGAAATTTCCGGAGAACCACTCCTAGATATTTTAAAACCA ATGGTTTTGGAAAACGGAAGGCCCCCATATACTGTTAATGAATGGTGGGATTTGACCAAA AGAGTTTATAATGCACAACAATTAATGAGAGATTATTACCTTTCTTTCCCGGAATCAGAA AGGCCTGATGTTATCATATCTCCTACAACGCTGATGCCATTTAGGCCTGGTGACATGCTA AAGACAACTTTACGATACATTTTACTATTCAACGTTTTAAATTTCCCATCATTATCTATA CCTGTAGGTAGTGTCGATTGCCAAATTGATGGGCTAATGGATACCACTTCTGCGCTCAAT CCAGAAGATAAAATGATCAAAACATATTGGAATGATTTAATACAATCTGGTGAGATAGAT GGGTTTCCAATAGGCCTACAAGTAGTTAGCCCGACTTTCAATGACAATGAAGTTTGTAAA TTTGCGTCTTGGCTTTTTAGCAAAATATAG
Protein Properties
Pfam Domain Function
Protein Residues549
Protein Molecular Weight61409.5
Protein Theoretical pI5.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Probable amidase MTVHSTWKEKVQLKKDQLNSKIKDEWKLNSTTITRLKNDKKNLIKNIDDLCSSSENQITH STIMALRQALEAKELSCHEITAAFCHRAALIHQVVNCLSEIMFSEALRLADYYDSNRPAI LPPLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVP SSMMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSY QGLFGLKPTFGRVPYLRVDNSFEGRETIPSVIGPLARDLSDLRYFMSCVINICQPWVQDV KCIPYHFDSSTSKLHDNYVVGIWYGDGVIDPPPSDIRALKTCEDLVNKTKGMKAVKWEPS SELSRELFDLANEADVADSGNEIKNEFEISGEPLLDILKPMVLENGRPPYTVNEWWDLTK RVYNAQQLMRDYYLSFPESERPDVIISPTTLMPFRPGDMLKTTLRYILLFNVLNFPSLSI PVGSVDCQIDGLMDTTSALNPEDKMIKTYWNDLIQSGEIDGFPIGLQVVSPTFNDNEVCK FASWLFSKI
References
External Links
ResourceLink
Saccharomyces Genome Database AMD2
Uniprot IDP22580
Uniprot NameAMDY_YEAST
GenBank Gene IDAY723784
Genebank Protein ID51830255
General Reference
  • Chang, T. H., Abelson, J. (1990). "Identification of a putative amidase gene in yeast Saccharomyces cerevisiae." Nucleic Acids Res 18:7180.2263500
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287