Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSerine/threonine-protein kinase VPS15
Synonyms
  • Golgi-retention defective mutant protein 8
  • Vacuolar protein sorting-associated protein 15
Gene NameVPS15
Enzyme ClassNot Available
Biological Properties
General Functionvacuole inheritance
Specific FunctionSerine/threonine-protein kinase required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific VPS34 PI3-kinase complex I. This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure. Is also involved in endosome-to-Golgi retrograde transport as part of the VPS34 PI3-kinase complex II. This second complex is required for the endosome-to-Golgi retrieval of PEP1 and KEX2, and the recruitment of VPS5 and VPS7, two components of the retromer complex, to endosomal membranes (probably through the synthesis of a specific pool of phosphatidylinositol 3-phosphate recruiting the retromer to the endosomes). By regulating VPS34 kinase activity, VPS15 appears to be essential for the efficient delivery of soluble hydrolases to the yeast vacuole.
Cellular LocationNot Available
SMPDB Pathways
Inositol MetabolismPW002498 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
1-Phosphatidyl-D-myo-inositol + Adenosine triphosphate1-Phosphatidyl-1D-myo-inositol 3-phosphate + ADP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00914ADPShow
YMDB161651-Phosphatidyl-1D-myo-inositol 3-phosphateShow
GO Classification
Function
protein serine/threonine kinase activity
vacuole inheritance
endosome membrane
Golgi apparatus
protein phosphorylation
late endosome
nucleus-vacuole junction
phosphatidylinositol 3-kinase complex, class III, type I
phosphatidylinositol 3-kinase complex, class III, type II
ubiquitin binding
inositol lipid-mediated signaling
late endosome to vacuole transport
macroautophagy
pexophagy
positive regulation of transcription elongation from RNA polymerase II promoter
protein retention in Golgi apparatus
ATP binding
protein targeting to vacuole
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>4365 bp ATGGGGGCACAATTATCACTAGTGGTCCAAGCATCACCTTCCATAGCCATTTTTTCATAT ATCGATGTCTTAGAGGAAGTACACTACGTTTCACAGTTAAACTCATCAAGATTCTTAAAA ACATGCAAGGCACTGGACCCTAACGGCGAAATTGTTATCAAAGTGTTTATTAAACCAAAA GACCAATATAGCTTACGACCTTTTCTCCAACGTATAAGGGCTCAATCGTTTAAGTTGGGA CAACTACCGCACGTTTTAAACTACAGTAAATTGATCGAGACAAATAGAGCCGGCTACATG ATACGGCAGCACTTAAAAAATAATTTATATGACAGATTGAGTTTGAGACCTTACTTACAA GACATTGAACTGAAATTCATTGCTTTCCAGTTGTTAAATGCATTAAAGGACATTCATAAT CTGAATATTGTCCATGGTGATATAAAGACAGAAAATATCCTAGTAACAAGTTGGAATTGG TGTATATTGACAGATTTTGCTGCATTTATCAAACCCGTATATTTGCCTGAAGATAATCCA GGTGAATTTTTATTCTACTTCGACACCTCGAAGAGAAGAACCTGTTATCTAGCCCCGGAG AGGTTTAACTCTAAACTTTACCAAGATGGAAAATCTAACAATGGTAGGCTAACTAAAGAA ATGGACATATTTAGTCTTGGATGTGTTATTGCAGAAATATTTGCTGAAGGAAGACCCATC TTCAACTTATCACAGCTATTCAAATATAAAAGTAATTCATATGACGTAAACAGGGAATTT CTCATGGAGGAAATGAATTCTACCGATTTAAGGAACTTGGTTCTAGACATGATTCAACTA GATCCATCCAAAAGACTTTCATGTGATGAACTACTGAATAAATATCGTGGCATTTTCTTC CCCGATTATTTCTACACTTTCATTTATGATTATTTCAGAAATTTGGTTACTATGACAACA AGCACACCGATATCAGATAACACTTGCACCAATAGTACCTTGGAAGACAATGTAAAACTT TTAGATGAAACTACGGAAAAAATATACAGAGATTTTTCCCAAATATGTCATTGTTTGGAC TTTCCTTTAATAAAAGACGGGGGTGAGATTGGTTCAGACCCCCCAATTTTGGAATCTTAC AAAATAGAGATAGAAATTAGTCGGTTTTTAAACACAAACTTATATTTCCCCCAAAATTAC CATTTAGTCTTACAGCAGTTTACCAAAGTATCCGAAAAGATAAAATCAGTTAAAGAGGAA TGTGCCTTACTCTTTATCTCTTATTTGTCTCATAGTATAAGAAGTATTGTTTCGACTGCT ACGAAACTTAAAAATTTAGAACTATTAGCAGTATTTGCACAATTCGTTTCTGATGAAAAT AAAATTGATCGAGTCGTACCTTATTTCGTATGTTGTTTTGAAGATAGTGACCAGGACGTC CAGGCCCTATCTTTGTTAACATTAATCCAGGTACTCACCTCTGTAAGAAAATTGAATCAA TTGAACGAGAATATATTTGTGGACTACTTACTTCCGAGACTGAAAAGATTACTTATTTCC AATAGGCAGAATACCAATTATTTAAGGATTGTGTTTGCTAATTGTTTGAGCGACTTGGCC ATTATCATTAATAGATTTCAAGAATTTACATTTGCTCAGCACTGCAATGATAACTCAATG GATAACAACACGGAAATCATGGAAAGCAGTACCAAGTATTCAGCAAAATTGATCCAAAGT GTCGAAGATTTAACTGTCTCTTTTTTAACAGATAATGATACTTATGTAAAGATGGCACTT TTGCAAAACATTCTTCCACTTTGTAAATTTTTTGGTAGGGAAAGAACAAACGATATTATA CTGAGTCATTTAATAACCTACCTTAATGATAAGGACCCAGCATTGCGAGTTTCCTTAATT CAAACAATATCCGGAATATCAATTCTTTTGGGTACCGTTACATTAGAACAGTATATTTTA CCATTGTTAATCCAGACCATCACTGATTCGGAAGAATTAGTAGTGATCAGTGTTTTACAA AGCTTAAAATCTTTGTTCAAGACTGGGTTGATTAGGAAAAAATATTATATTGATATATCA AAAACAACATCTCCCTTGTTGTTGCATCCTAATAATTGGATAAGACAGTTTACTTTGATG ATAATTATAGAAATTATTAATAAGTTATCAAAAGCCGAAGTGTACTGCATTCTCTATCCA ATAATAAGGCCTTTCTTCGAATTTGACGTTGAGTTCAACTTCAAATCAATGATAAGCTGT TGCAAGCAACCAGTGTCAAGATCGGTTTACAATCTATTGTGTAGTTGGTCTGTTAGAGCG TCAAAATCTTTATTTTGGAAAAAAATCATCACAAATCATGTAGATTCATTCGGAAATAAT AGAATCGAATTTATAACAAAAAATTACTCAAGTAAAAATTATGGATTTAATAAAAGAGAT ACGAAATCAAGTTCCTCGCTGAAGGGTATTAAAACATCATCCACCGTCTATTCACATGAC AACAAGGAAATTCCCTTAACTGCTGAAGACAGAAATTGGATTGATAAGTTCCACATTATT GGGCTAACAGAAAAAGATATTTGGAAAATTGTGGCTTTGAGGGGTTATGTAATAAGGACA GCGAGAGTTATGGCAGCGAACCCTGATTTTCCATATAATAATAGTAATTACCGTCCATTA GTACAGAACTCACCACCTAACCTAAACCTTACGAATATTATGCCAAGAAACATTTTCTTT GATGTAGAGTTTGCTGAAGAGTCGACAAGTGAGGGACAAGATTCTAACTTAGAGAACCAA CAGATATATAAATATGATGAAAGTGAGAAAGATAGCAATAAGCTAAATATTAACGGTAGC AAACAGCTATCTACCGTCATGGACATAAATGGATCACTAATATTCAAAAATAAGTCCATT GCCACTACTACTTCTAATTTGAAGAACGTTTTTGTTCAGTTAGAACCAACGTCCTATCAC ATGCATTCTCCAAATCATGGCTTGAAAGATAATGCAAATGTTAAACCAGAAAGGAAGGTA GTCGTCAGCAACAGCTATGAAGGCGACGTTGAAAGCATAGAAAAATTCCTATCGACTTTC AAAATTTTACCTCCTCTGAGAGATTATAAGGAGTTTGGGCCTATTCAAGAGATTGTACGG AGTCCAAACATGGGTAATTTGAGGGGCAAGTTGATAGCTACTTTGATGGAAAACGAACCC AATTCTATTACGTCTTCTGCTGTTTCTCCAGGAGAAACACCCTATTTAATAACAGGTTCA GATCAAGGTGTAATCAAGATTTGGAACCTGAAAGAGATTATCGTGGGCGAGGTTTACTCT TCTTCTTTAACTTATGACTGCTCCTCTACCGTAACTCAGATAACCATGATTCCTAACTTT GACGCGTTTGCCGTTTCCAGTAAAGATGGACAAATAATTGTATTAAAGGTTAATCATTAC CAACAAGAAAGTGAAGTCAAATTTTTGAATTGCGAATGCATCAGGAAAATTAACTTGAAG AATTTTGGTAAAAATGAATACGCAGTGAGAATGAGAGCATTTGTGAATGAGGAAAAATCT CTACTAGTAGCATTGACGAATTTGTCAAGGGTTATTATATTTGATATTAGAACCCTGGAG AGGTTACAAATTATAGAGAATTCTCCAAGGCATGGTGCCGTTTCAAGCATCTGTATCGAT GAAGAGTGTTGTGTCCTAATTTTGGGGACGACTAGAGGTATTATTGATATATGGGATATC CGTTTCAACGTGCTGATAAGGAGTTGGTCCTTTGGGGACCACGCACCAATCACGCATGTG GAGGTTTGTCAGTTTTATGGAAAGAATTCTGTAATTGTTGTAGGAGGTAGTTCAAAAACA TTTCTAACAATATGGAATTTTGTTAAGGGGCATTGTCAGTATGCTTTCATAAATTCTGAT GAACAGCCATCTATGGAGCACTTTTTACCAATTGAGAAAGGCTTAGAAGAATTAAATTTT TGTGGAATCAGGTCTTTAAACGCACTAAGCACTATCTCAGTATCTAATGATAAAATTCTT CTTACCGATGAAGCAACAAGTTCCATTGTTATGTTTAGCCTAAATGAGCTTTCTTCTTCT AAAGCAGTAATAAGTCCTTCAAGATTCAGTGACGTTTTTATTCCTACACAAGTTACGGCA AATCTCACAATGTTATTGAGAAAAATGAAACGTACTAGCACTCATTCAGTAGATGATTCT CTATATCATCATGATATTATAAATTCTATATCTACATGTGAAGTTGATGAGACACCTTTG CTGGTTGCTTGTGATAACTCAGGGCTTATTGGAATCTTCCAATAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues1454
Protein Molecular Weight166370.295
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Serine/threonine-protein kinase VPS15 MGAQLSLVVQASPSIAIFSYIDVLEEVHYVSQLNSSRFLKTCKALDPNGEIVIKVFIKPK DQYSLRPFLQRIRAQSFKLGQLPHVLNYSKLIETNRAGYMIRQHLKNNLYDRLSLRPYLQ DIELKFIAFQLLNALKDIHNLNIVHGDIKTENILVTSWNWCILTDFAAFIKPVYLPEDNP GEFLFYFDTSKRRTCYLAPERFNSKLYQDGKSNNGRLTKEMDIFSLGCVIAEIFAEGRPI FNLSQLFKYKSNSYDVNREFLMEEMNSTDLRNLVLDMIQLDPSKRLSCDELLNKYRGIFF PDYFYTFIYDYFRNLVTMTTSTPISDNTCTNSTLEDNVKLLDETTEKIYRDFSQICHCLD FPLIKDGGEIGSDPPILESYKIEIEISRFLNTNLYFPQNYHLVLQQFTKVSEKIKSVKEE CALLFISYLSHSIRSIVSTATKLKNLELLAVFAQFVSDENKIDRVVPYFVCCFEDSDQDV QALSLLTLIQVLTSVRKLNQLNENIFVDYLLPRLKRLLISNRQNTNYLRIVFANCLSDLA IIINRFQEFTFAQHCNDNSMDNNTEIMESSTKYSAKLIQSVEDLTVSFLTDNDTYVKMAL LQNILPLCKFFGRERTNDIILSHLITYLNDKDPALRVSLIQTISGISILLGTVTLEQYIL PLLIQTITDSEELVVISVLQSLKSLFKTGLIRKKYYIDISKTTSPLLLHPNNWIRQFTLM IIIEIINKLSKAEVYCILYPIIRPFFEFDVEFNFKSMISCCKQPVSRSVYNLLCSWSVRA SKSLFWKKIITNHVDSFGNNRIEFITKNYSSKNYGFNKRDTKSSSSLKGIKTSSTVYSHD NKEIPLTAEDRNWIDKFHIIGLTEKDIWKIVALRGYVIRTARVMAANPDFPYNNSNYRPL VQNSPPNLNLTNIMPRNIFFDVEFAEESTSEGQDSNLENQQIYKYDESEKDSNKLNINGS KQLSTVMDINGSLIFKNKSIATTTSNLKNVFVQLEPTSYHMHSPNHGLKDNANVKPERKV VVSNSYEGDVESIEKFLSTFKILPPLRDYKEFGPIQEIVRSPNMGNLRGKLIATLMENEP NSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDCSSTVTQITMIPNF DAFAVSSKDGQIIVLKVNHYQQESEVKFLNCECIRKINLKNFGKNEYAVRMRAFVNEEKS LLVALTNLSRVIIFDIRTLERLQIIENSPRHGAVSSICIDEECCVLILGTTRGIIDIWDI RFNVLIRSWSFGDHAPITHVEVCQFYGKNSVIVVGGSSKTFLTIWNFVKGHCQYAFINSD EQPSMEHFLPIEKGLEELNFCGIRSLNALSTISVSNDKILLTDEATSSIVMFSLNELSSS KAVISPSRFSDVFIPTQVTANLTMLLRKMKRTSTHSVDDSLYHHDIINSISTCEVDETPL LVACDNSGLIGIFQ
References
External Links
ResourceLink
Saccharomyces Genome Database VPS15
Uniprot IDP22219
Uniprot NameVPS15
PDB ID
3GRE
General ReferenceNot Available