You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Synonyms
  • 2-oxoglutarate dehydrogenase complex component E2
  • OGDC-E2
  • Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Gene NameKGD2
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionThe 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components:2- oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3)
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Lysine degradationec00310 Map00310
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00514Succinyl-CoAShow
GO Classification
Component
oxoglutarate dehydrogenase complex
macromolecular complex
protein complex
Function
S-acyltransferase activity
S-succinyltransferase activity
dihydrolipoyllysine-residue succinyltransferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
catalytic activity
transferase activity
Process
cofactor metabolic process
coenzyme metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR148C
Gene Sequence>1392 bp ATGCTTTCCAGAGCGACGCGTACTGCAGCTGCCAAATCCTTAGTAAAATCTAAAGTGGCT AGAAATGTTATGGCTGCTTCTTTCGTCAAGAGACATGCTTCTACAAGTTTGTTCAAACAA GCTAACAAGGTCGAATCCTTAGGTTCAATATATTTATCCGGCAAGAAAATTTCAGTTGCG GCGAATCCGTTCTCCATAACTAGCAATCGTTTTAAATCTACCTCTATTGAAGTTCCTCCG ATGGCAGAGTCCCTGACTGAAGGCTCTTTAAAGGAATATACTAAAAACGTTGGTGATTTT ATTAAGGAGGACGAGCTGTTGGCCACTATTGAGACCGATAAAATTGATATTGAGGTCAAT TCGCCAGTATCAGGTACTGTTACGAAGCTAAATTTCAAACCAGAGGACACTGTCACTGTT GGTGAGGAGTTAGCTCAGGTCGAGCCTGGTGAAGCACCTGCTGAGGGTTCTGGAGAATCT AAGCCAGAGCCTACCGAACAAGCGGAGCCATCGCAAGGTGTCGCCGCAAGGGAAAACTCA AGTGAGGAAACGGCTTCAAAGAAAGAAGCTGCTCCAAAGAAAGAAGCCGCTCCAAAGAAA GAAGTTACAGAACCAAAAAAGGCTGATCAACCAAAGAAGACCGTCTCTAAGGCGCAGGAA CCCCCAGTAGCCTCTAACTCTTTCACACCATTTCCACGTACAGAAACCAGGGTCAAAATG AACCGTATGAGATTGAGGATTGCCGAAAGATTAAAAGAGTCTCAAAACACTGCTGCTTCC TTAACCACATTCAACGAAGTTGACATGTCAGCTTTGATGGAAATGAGGAAACTGTATAAA GATGAGATTATTAAGAAGACCGGTACTAAATTCGGATTCATGGGTCTTTTCTCCAAAGCA TGTACCTTGGCCGCCAAGGATATTCCAGCCGTCAATGGTGCCATTGAAGGTGACCAGATT GTTTATCGTGATTACACAGATATTTCTGTTGCTGTGGCCACTCCAAAGGGTTTGGTTACC CCCGTCGTTCGTAATGCAGAGTCATTGAGTGTTTTAGATATTGAGAACGAAATTGTTCGC TTGAGTCATAAAGCGCGTGATGGCAAATTAACCCTAGAAGATATGACGGGTGGTACTTTC ACCATATCTAATGGTGGTGTTTTTGGTTCATTATACGGTACTCCTATCATCAATTCACCA CAAACAGCCGTCCTAGGCTTGCATGGTGTCAAAGAGAGACCTGTCACTGTTAATGGACAA ATTGTCTCAAGACCAATGATGTACTTGGCTTTGACTTATGATCATAGATTGCTAGATGGT AGAGAAGCTGTTACCTTCTTGAAGACTGTTAAAGAGTTGATTGAAGACCCTAGAAAAATG TTGTTATGGTGA
Protein Properties
Pfam Domain Function
Protein Residues463
Protein Molecular Weight50430.30078
Protein Theoretical pI9.44
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial MLSRATRTAAAKSLVKSKVARNVMAASFVKRHASTSLFKQANKVESLGSIYLSGKKISVA ANPFSITSNRFKSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVN SPVSGTVTKLNFKPEDTVTVGEELAQVEPGEAPAEGSGESKPEPTEQAEPSQGVAARENS SEETASKKEAAPKKEAAPKKEVTEPKKADQPKKTVSKAQEPPVASNSFTPFPRTETRVKM NRMRLRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTKFGFMGLFSKA CTLAAKDIPAVNGAIEGDQIVYRDYTDISVAVATPKGLVTPVVRNAESLSVLDIENEIVR LSHKARDGKLTLEDMTGGTFTISNGGVFGSLYGTPIINSPQTAVLGLHGVKERPVTVNGQ IVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPRKMLLW
References
External Links
ResourceLink
Saccharomyces Genome Database KGD2
Uniprot IDP19262
Uniprot NameODO2_YEAST
GenBank Gene IDZ50046
Genebank Protein ID899398
General Reference
  • Repetto, B., Tzagoloff, A. (1990). "Structure and regulation of KGD2, the structural gene for yeast dihydrolipoyl transsuccinylase." Mol Cell Biol 10:4221-4232.2115121
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666