You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTransaldolase
SynonymsNot Available
Gene NameTAL1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionTransaldolase is important for the balance of metabolites in the pentose-phosphate pathway
Cellular LocationNot Available
SMPDB Pathways
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
SMPDB Reactions
D-Glyceraldehyde 3-phosphate + D-Sedoheptulose 7-phosphateD-Erythrose 4-phosphate + β-D-fructofuranose 6-phosphate
KEGG Reactions
D-Glyceraldehyde 3-phosphate + D-Sedoheptulose 7-phosphateD-Erythrose 4-phosphate + Fructose 6-phosphate
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00115D-Glyceraldehyde 3-phosphateShow
YMDB00196D-Sedoheptulose 7-phosphateShow
YMDB00223D-Erythrose 4-phosphateShow
YMDB00752Sedoheptulose 7-phosphateShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
transferase activity, transferring aldehyde or ketonic groups
transaldolase activity
catalytic activity
transferase activity
Process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
pentose-phosphate shunt
metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1008 bp ATGTCTGAACCAGCTCAAAAGAAACAAAAGGTTGCTAACAACTCTCTAGAACAATTGAAA GCCTCCGGCACTGTCGTTGTTGCCGACACTGGTGATTTCGGCTCTATTGCCAAGTTTCAA CCTCAAGACTCCACAACTAACCCATCATTGATCTTGGCTGCTGCCAAGCAACCAACTTAC GCCAAGTTGATCGATGTTGCCGTGGAATACGGTAAGAAGCATGGTAAGACCACCGAAGAA CAAGTCGAAAATGCTGTGGACAGATTGTTAGTCGAATTCGGTAAGGAGATCTTAAAGATT GTTCCAGGCAGAGTCTCCACCGAAGTTGATGCTAGATTGTCTTTTGACACTCAAGCTACC ATTGAAAAGGCTAGACATATCATTAAATTGTTTGAACAAGAAGGTGTCTCCAAGGAAAGA GTCCTTATTAAAATTGCTTCCACTTGGGAAGGTATTCAAGCTGCCAAAGAATTGGAAGAA AAGGACGGTATCCACTGTAATTTGACTCTATTATTCTCCTTCGTTCAAGCAGTTGCCTGT GCCGAGGCCCAAGTTACTTTGATTTCCCCATTTGTTGGTAGAATTCTAGACTGGTACAAA TCCAGCACTGGTAAAGATTACAAGGGTGAAGCCGACCCAGGTGTTATTTCCGTCAAGAAA ATCTACAACTACTACAAGAAGTACGGTTACAAGACTATTGTTATGGGTGCTTCTTTCAGA AGCACTGACGAAATCAAAAACTTGGCTGGTGTTGACTATCTAACAATTTCTCCAGCTTTA TTGGACAAGTTGATGAACAGTACTGAACCTTTCCCAAGAGTTTTGGACCCTGTCTCCGCT AAGAAGGAAGCCGGCGACAAGATTTCTTACATCAGCGACGAATCTAAATTCAGATTCGAC TTGAATGAAGACGCTATGGCCACTGAAAAATTGTCCGAAGGTATCAGAAAATTCTCTGCC GATATTGTTACTCTATTCGACTTGATTGAAAAGAAAGTTACCGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues335
Protein Molecular Weight37036.0
Protein Theoretical pI6.33
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Transaldolase MSEPAQKKQKVANNSLEQLKASGTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTY AKLIDVAVEYGKKHGKTTEEQVENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQAT IEKARHIIKLFEQEGVSKERVLIKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVAC AEAQVTLISPFVGRILDWYKSSTGKDYKGEADPGVISVKKIYNYYKKYGYKTIVMGASFR STDEIKNLAGVDYLTISPALLDKLMNSTEPFPRVLDPVSAKKEAGDKISYISDESKFRFD LNEDAMATEKLSEGIRKFSADIVTLFDLIEKKVTA
References
External Links
ResourceLink
Saccharomyces Genome Database TAL1
Uniprot IDP15019
Uniprot NameTAL1_YEAST
GenBank Gene IDU19102
Genebank Protein ID609402
General Reference
  • Schaaff, I., Hohmann, S., Zimmermann, F. K. (1990). "Molecular analysis of the structural gene for yeast transaldolase." Eur J Biochem 188:597-603.2185015
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Petersen, J. G., Holmberg, S. (1986). "The ILV5 gene of Saccharomyces cerevisiae is highly expressed." Nucleic Acids Res 14:9631-9651.3027658
  • Miosga, T., Schaaff-Gerstenschlager, I., Franken, E., Zimmermann, F. K. (1993). "Lysine144 is essential for the catalytic activity of Saccharomyces cerevisiae transaldolase." Yeast 9:1241-1249.8109173
  • Garrels, J. I., McLaughlin, C. S., Warner, J. R., Futcher, B., Latter, G. I., Kobayashi, R., Schwender, B., Volpe, T., Anderson, D. S., Mesquita-Fuentes, R., Payne, W. E. (1997). "Proteome studies of Saccharomyces cerevisiae: identification and characterization of abundant proteins." Electrophoresis 18:1347-1360.9298649
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956