You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameL-serine dehydratase
Synonyms
  • L-serine deaminase
Gene NameSDL1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionL-serine = pyruvate + NH(3)
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Glycine, serine and threonine metabolismec00260 Map00260
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00112L-SerineShow
YMDB00175Pyruvic acidShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
cofactor binding
pyridoxal phosphate binding
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL167W
Gene Sequence>384 bp ATGGAAATGACTTACTATGAAAAGACACCTTTGATTCGTCAATTTTTGAACAATGGTAAG ACAAATTCGTGGTTTTACGTTAAGCATGAGATGTTACAACCAGGTGGAAGTTTCAAATCG AGAGGAATCGGGCATTTGATAAGGAAGAGTAATGAAGAAGCGCTAAGCGAGGGTTCTGGG AAGCTTGCTGTATTTTCTAGCTCTGGGGGAAATGCTGGTTTAGCAGCAGCAACTGCCTGC AGATCGATGGCACTTAATTGCAGTGTAGTGGTTCCTAAAACTACAAAACCTAGAATGGTA AAGAAAATTCAAAGTGCAGGAGCCAAAGTCATTATCCATGGTGATCATTGGGGGGAAGCA GATGAATACTTGAGGCACGAATGA
Protein Properties
Pfam Domain Function
Protein Residues127
Protein Molecular Weight13942.90039
Protein Theoretical pI9.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>L-serine dehydratase MEMTYYEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSG KLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEA DEYLRHE
References
External Links
ResourceLink
Saccharomyces Genome Database SDL1
Uniprot IDP0CF21
Uniprot NameSDH1_YEAST
GenBank Gene IDAY558344
Genebank Protein ID45270578
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287