You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
Synonyms
  • GlcNAc-1-P transferase
  • G1PT
  • GPT
  • N-acetylglucosamine-1-phosphate transferase
  • Tunicamycin resistance protein 1
Gene NameALG7
Enzyme Class
Biological Properties
General FunctionInvolved in phospho-N-acetylmuramoyl-pentapeptide-transferase activity
Specific FunctionCatalyzes the initial step in the synthesis of dolichol- P-P-oligosaccharides
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB Reactions
Dolichol phosphate + Uridine diphosphate-N-acetylglucosamineUridine 5'-monophosphate + N-acetyl-α-D-glucosaminyl-diphosphodolichol
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00864Dolichol phosphateShow
YMDB00928Dolichol-20Show
YMDB00934N-acetyl-D-glucosaminyldiphosphodolicholShow
YMDB00941dolichyl phosphateShow
YMDB16336N-acetyl-α-D-glucosaminyl-diphosphodolicholShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
phospho-N-acetylmuramoyl-pentapeptide-transferase activity
catalytic activity
transferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR243C
Gene Sequence>1347 bp ATGTTGCGACTTTTTTCACTGGCACTTATCACATGCTTAATCTACTATTCCAAAAATCAG GGCCCATCTGCTCTTGTTGCGGCCGTGGGATTTGGTATAGCAGGCTATTTAGCTACAGAT ATGTTGATTCCACGTGTGGGCAAATCCTTCATCAAAATAGGCCTATTCGGTAAGGACTTG AGTAAACCTGGCCGTCCGGTGCTTCCAGAAACAATAGGTGCTATCCCTGCTGCAGTTTAT TTATTTGTAATGTTCATTTACATTCCCTTCATTTTCTACAAGTATATGGTCATAACCACT TCAGGTGGGGGCCATCGCGATGTCTCAGTGGTTGAAGATAACGGTATGAATTCTAATATT TTTCCTCATGATAAACTATCTGAATATTTGAGCGCTATCCTATGCTTGGAAAGTACGGTC CTCTTGGGTATCGCTGATGATTTATTTGATTTACGTTGGAGACATAAGTTTTTCTTGCCT GCCATTGCAGCCATCCCACTGCTAATGGTTTATTATGTGGATTTTGGAGTTACGCATGTA CTTATTCCCGGATTCATGGAACGCTGGTTGAAAAAGACTAGTGTTGATTTGGGGCTGTGG TATTATGTTTATATGGCATCGATGGCAATTTTTTGCCCCAACTCCATCAACATCCTGGCA GGTGTTAATGGTTTAGAGGTTGGCCAATGTATAGTGTTGGCCATCTTAGCGCTATTGAAC GATTTGCTGTACTTCTCGATGGGGCCATTAGCCACAAGAGACTCCCATAGGTTTTCCGCT GTTTTGATTATCCCATTTTTGGGTGTATCCTTGGCGCTATGGAAATGGAATCGTTGGCCC GCCACAGTGTTTGTGGGAGATACATATTGTTATTTCGCTGGAATGGTATTCGCAGTCGTT GGTATACTGGGTCATTTTTCAAAGACGATGCTTTTGCTATTCATTCCTCAAATCGTTAAT TTTATTTATTCATGTCCTCAGCTATTCAAATTGGTCCCCTGCCCGAGACATAGGTTACCT AAATTTAATGAAAAAGACGGTTTAATGTATCCATCAAGAGCAAACTTAAAAGAAGAACCG CCAAAGAGCATTTTTAAACCGATCTTGAAGTTACTATACTGTCTCCATTTGATTGACCTG GAATTTGATGAAAATAATGAGATTATTAGCACCTCTAATATGACGTTAATAAACTTGACA TTAGTATGGTTTGGCCCTATGAGGGAAGACAAATTGTGCAATACAATCTTGAAGTTGCAA TTCTGCATTGGAATTTTGGCTTTACTTGGAAGACACGCTATAGGCGCTATCATCTTTGGC CACGACAACCTATGGACAGTACGTTGA
Protein Properties
Pfam Domain Function
Protein Residues448
Protein Molecular Weight50367.39844
Protein Theoretical pI8.51
Signalling Regions
  • None
Transmembrane Regions
  • 24-44
  • 72-92
  • 129-149
  • 157-177
  • 202-222
  • 231-251
  • 256-276
  • 283-303
  • 309-329
  • 387-407
  • 419-439
Protein Sequence>UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSFIKIGLFGKDL SKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITTSGGGHRDVSVVEDNGMNSNI FPHDKLSEYLSAILCLESTVLLGIADDLFDLRWRHKFFLPAIAAIPLLMVYYVDFGVTHV LIPGFMERWLKKTSVDLGLWYYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLN DLLYFSMGPLATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMYPSRANLKEEP PKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLTLVWFGPMREDKLCNTILKLQ FCIGILALLGRHAIGAIIFGHDNLWTVR
References
External Links
ResourceLink
Saccharomyces Genome Database ALG7
Uniprot IDP07286
Uniprot NameGPT_YEAST
GenBank Gene IDY00126
Genebank Protein ID4685
General Reference
  • Hartog, K. O., Bishop, B. (1987). "Genomic sequence coding for tunicamycin resistance in yeast." Nucleic Acids Res 15:3627.3033607
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418