You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameATP synthase subunit alpha, mitochondrial
SynonymsNot Available
Gene NameATP1
Enzyme ClassNot Available
Biological Properties
General FunctionEnergy production and conversion
Specific FunctionMitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites
Cellular LocationMitochondrion inner membrane.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Component
proton-transporting two-sector ATPase complex
proton-transporting ATP synthase complex, catalytic core F(1)
macromolecular complex
protein complex
proton-transporting two-sector ATPase complex, catalytic domain
Function
ion transmembrane transporter activity
hydrolase activity
cation transmembrane transporter activity
hydrolase activity, acting on acid anhydrides
inorganic cation transmembrane transporter activity
nucleoside binding
monovalent inorganic cation transmembrane transporter activity
purine nucleoside binding
hydrogen ion transmembrane transporter activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
proton-transporting ATPase activity, rotational mechanism
hydrogen ion transporting ATP synthase activity, rotational mechanism
binding
catalytic activity
transporter activity
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
ATP synthesis coupled proton transport
proton transport
purine nucleoside triphosphate metabolic process
purine ribonucleoside triphosphate metabolic process
ATP metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
establishment of localization
nucleotide metabolic process
transport
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
hydrogen transport
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1638 bp ATGTTGGCTCGTACTGCTGCTATTCGTTCTCTATCGAGAACTCTAATTAACTCTACCAAG GCCGCAAGACCTGCCGCTGCTGCTTTGGCTTCCACCAGAAGATTGGCTTCCACCAAGGCA CAACCCACAGAAGTTTCCTCCATCTTAGAGGAAAGAATTAAGGGTGTGTCCGACGAGGCC AATTTGAACGAAACTGGTAGAGTTCTTGCAGTCGGTGATGGTATTGCTCGTGTTTTTGGT TTGAACAACATTCAGGCTGAAGAATTGGTCGAGTTCTCCTCTGGTGTTAAAGGTATGGCT TTGAACTTGGAGCCTGGTCAAGTCGGTATCGTTCTTTTCGGTTCCGATAGACTGGTTAAA GAAGGTGAATTGGTCAAGAGAACCGGTAATATTGTTGATGTCCCAGTCGGTCCAGGCCTT TTGGGTAGAGTTGTCGACGCTTTAGGTAACCCTATTGATGGTAAAGGTCCTATTGACGCT GCCGGTCGTTCAAGAGCTCAAGTCAAAGCACCAGGTATTTTGCCAAGAAGATCTGTCCAT GAACCAGTTCAAACCGGTTTGAAAGCCGTTGACGCCTTGGTCCCTATCGGTAGAGGTCAA AGAGAGTTGATTATTGGTGATCGTCAAACAGGTAAGACTGCTGTCGCCTTAGACACCATC TTGAATCAAAAGAGATGGAATAACGGTAGTGACGAATCCAAGAAACTTTACTGTGTTTAC GTTGCCGTTGGACAAAAAAGATCTACCGTTGCTCAATTGGTCCAAACTTTGGAACAACAT GACGCCATGAAGTACTCTATTATTGTTGCAGCTACTGCATCTGAAGCCGCTCCTCTACAA TACTTGGCTCCATTTACTGCCGCATCCATTGGTGAATGGTTCAGAGATAATGGAAAGCAC GCTTTGATCGTCTATGACGATTTGTCCAAGCAAGCCGTGGCATACCGTCAATTATCTTTG TTGTTGAGACGTCCTCCTGGTCGTGAAGCCTACCCTGGTGATGTCTTTTACTTGCATTCA AGATTGCTAGAAAGAGCCGCTAAGCTTTCTGAAAAGGAAGGTTCTGGTTCTTTAACTGCT TTGCCTGTTATTGAAACCCAAGGTGGTGATGTCTCCGCTTATATTCCAACCAATGTTATT TCCATTACCGATGGTCAAATTTTCTTGGAAGCTGAATTATTCTACAAGGGTATCAGACCT GCCATTAACGTTGGTTTGTCCGTTTCTCGTGTCGGTTCCGCTGCTCAAGTTAAGGCTTTG AAGCAAGTCGCTGGTTCCTTGAAATTGTTTTTGGCTCAATACAGAGAAGTCGCTGCTTTT GCTCAATTCGGTTCCGATTTAGATGCCTCCACCAAGCAAACTTTGGTTAGAGGTGAAAGA TTGACTCAATTGTTGAAGCAAAACCAATATTCTCCTTTGGCTACAGAAGAACAGGTTCCA TTGATTTATGCCGGTGTTAATGGTCATTTGGATGGTATTGAACTATCAAGAATTGGTGAA TTTGAGTCCTCCTTTTTGTCCTATCTAAAATCCAATCACAATGAGCTTTTGACCGAAATT CGAGAAAAGGGTGAATTGTCTAAAGAATTGTTGGCATCTCTAAAGAGTGCTACTGAATCA TTTGTTGCCACTTTTTAA
Protein Properties
Pfam Domain Function
Protein Residues545
Protein Molecular Weight58617.39844
Protein Theoretical pI9.5
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>ATP synthase subunit alpha, mitochondrial MLARTAAIRSLSRTLINSTKAARPAAAALASTRRLASTKAQPTEVSSILEERIKGVSDEA NLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVK EGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVH EPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVY VAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKH ALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHPRLLERAAKLSEKEGSGSLTA LPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKAL KQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVP LIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATES FVATF
References
External Links
ResourceLink
Saccharomyces Genome Database ATP1
Uniprot IDP07251
Uniprot NameATPA_YEAST
GenBank Gene IDAY692969
Genebank Protein ID51013389
General Reference
  • Takeda, M., Chen, W. J., Saltzgaber, J., Douglas, M. G. (1986). "Nuclear genes encoding the yeast mitochondrial ATPase complex. Analysis of ATP1 coding the F1-ATPase alpha-subunit and its assembly." J Biol Chem 261:15126-15133.2876995
  • Mabuchi, T., Ichimura, Y., Takeda, M., Douglas, M. G. (2000). "ASC1/RAS2 suppresses the growth defect on glycerol caused by the atp1-2 mutation in the yeast Saccharomyces cerevisiae." J Biol Chem 275:10492-10497.10744740
  • Obermaier, B., Gassenhuber, J., Piravandi, E., Domdey, H. (1995). "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II." Yeast 11:1103-1112.7502586
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Stock, D., Leslie, A. G., Walker, J. E. (1999). "Molecular architecture of the rotary motor in ATP synthase." Science 286:1700-1705.10576729