You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameImidazoleglycerol-phosphate dehydratase
Synonyms
  • IGPD
Gene NameHIS3
Enzyme Class
Biological Properties
General FunctionInvolved in imidazoleglycerol-phosphate dehydratase activity
Specific FunctionD-erythro-1-(imidazol-4-yl)glycerol 3- phosphate = 3-(imidazol-4-yl)-2-oxopropyl phosphate + H(2)O
Cellular LocationNot Available
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Histidine metabolismec00340 Map00340
SMPDB Reactions
D-Erythro-imidazole-glycerol-phosphatewater + Imidazole acetol-phosphate
KEGG Reactions
D-Erythro-imidazole-glycerol-phosphateImidazole acetol-phosphate + water
Metabolites
YMDB IDNameView
YMDB00070Imidazole acetol-phosphateShow
YMDB00089D-Erythro-imidazole-glycerol-phosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
carbon-oxygen lyase activity
hydro-lyase activity
imidazoleglycerol-phosphate dehydratase activity
catalytic activity
lyase activity
Process
histidine metabolic process
histidine biosynthetic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
histidine family amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR202W
Gene Sequence>663 bp ATGACAGAGCAGAAAGCCCTAGTAAAGCGTATTACAAATGAAACCAAGATTCAGATTGCG ATCTCTTTAAAGGGTGGTCCCCTAGCGATAGAGCACTCGATCTTCCCAGAAAAAGAGGCA GAAGCAGTAGCAGAACAGGCCACACAATCGCAAGTGATTAACGTCCACACAGGTATAGGG TTTCTGGACCATATGATACATGCTCTGGCCAAGCATTCCGGCTGGTCGCTAATCGTTGAG TGCATTGGTGACTTACACATAGACGACCATCACACCACTGAAGACTGCGGGATTGCTCTC GGTCAAGCTTTTAAAGAGGCCCTAGGGGCCGTGCGTGGAGTAAAAAGGTTTGGATCAGGA TTTGCGCCTTTGGATGAGGCACTTTCCAGAGCGGTGGTAGATCTTTCGAACAGGCCGTAC GCAGTTGTCGAACTTGGTTTGCAAAGGGAGAAAGTAGGAGATCTCTCTTGCGAGATGATC CCGCATTTTCTTGAAAGCTTTGCAGAGGCTAGCAGAATTACCCTCCACGTTGATTGTCTG CGAGGCAAGAATGATCATCACCGTAGTGAGAGTGCGTTCAAGGCTCTTGCGGTTGCCATA AGAGAAGCCACCTCGCCCAATGGTACCAACGATGTTCCCTCCACCAAAGGTGTTCTTATG TAG
Protein Properties
Pfam Domain Function
Protein Residues220
Protein Molecular Weight23833.0
Protein Theoretical pI6.37
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Imidazoleglycerol-phosphate dehydratase MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAEQATQSQVINVHTGIG FLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAFKEALGAVRGVKRFGSG FAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFLESFAEASRITLHVDCL RGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM
References
External Links
ResourceLink
Saccharomyces Genome Database HIS3
Uniprot IDP06633
Uniprot NameHIS7_YEAST
GenBank Gene IDAJ585705
Genebank Protein ID45720014
General Reference
  • Struhl, K. (1985). "Nucleotide sequence and transcriptional mapping of the yeast pet56-his3-ded1 gene region." Nucleic Acids Res 13:8587-8601.3001645
  • Leh-Louis, V., Wirth, B., Despons, L., Wain-Hobson, S., Potier, S., Souciet, J. L. (2004). "Differential evolution of the Saccharomyces cerevisiae DUP240 paralogs and implication of recombination in phylogeny." Nucleic Acids Res 32:2069-2078.15087486
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Struhl, K., Davis, R. W. (1981). "Promotor mutants of the yeast his3 gene." J Mol Biol 152:553-568.6173490
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106