You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTryptophan synthase
SynonymsNot Available
Gene NameTRP5
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionL-serine + 1-C-(indol-3-yl)glycerol 3- phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H(2)O
Cellular LocationNot Available
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
1-C-(3-indolyl)-glycerol 3-phosphateIndole + D-Glyceraldehyde 3-phosphate
L-Serine + Indolewater + L-Tryptophan
KEGG Reactions
L-Serine + 1-C-(indol-3-yl)glycerol 3-phosphateD-Glyceraldehyde 3-phosphate + water + L-Tryptophan
Metabolites
YMDB IDNameView
YMDB00112L-SerineShow
YMDB00115D-Glyceraldehyde 3-phosphateShow
YMDB00126L-TryptophanShow
YMDB00179(1S,2R)-1-C-(indol-3-yl)glycerol 3-phosphateShow
YMDB007091-C-(indol-3-yl)glycerol 3-phosphateShow
YMDB00890waterShow
YMDB16120IndoleShow
YMDB162771-C-(3-indolyl)-glycerol 3-phosphateShow
GO Classification
Component
Not Available
Function
binding
catalytic activity
cofactor binding
pyridoxal phosphate binding
carbon-oxygen lyase activity
lyase activity
hydro-lyase activity
tryptophan synthase activity
Process
cellular biogenic amine metabolic process
indolalkylamine metabolic process
tryptophan metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
metabolic process
cellular amino acid derivative metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL026C
Gene Sequence>2124 bp ATGTCAGAACAACTCAGACAAACATTTGCTAACGCTAAAAAAGAAAACAGGAACGCCTTG GTCACATTTATGACCGCAGGTTACCCAACAGTCAAAGACACTGTCCCTATTCTCAAGGGT TTCCAGGATGGTGGTGTAGATATCATCGAATTGGGTATGCCCTTCTCTGATCCAATTGCA GATGGTCCTACAATTCAATTATCTAATACTGTGGCTTTGCAAAACGGTGTTACCTTGCCT CAAACTCTAGAAATGGTCTCCCAAGCTAGAAATGAAGGTGTTACCGTACCCATAATCCTA ATGGGTTACTATAACCCTATTCTAAACTACGGTGAAGAAAGATTTATTCAGGACGCTGCC AAGGCTGGTGCTAATGGTTTTATCATCGTCGATTTGCCACCAGAGGAGGCGTTGAAGGTC AGAAACTACATCAATGATAATGGTTTGAGCCTGATCCCACTAGTGGCTCCTTCTACCACC GACGAAAGATTGGAATTACTATCACATATTGCCGATTCGTTTGTCTACGTTGTGTCTAGA ATGGGTACTACTGGTGTTCAAAGTTCTGTGGCCAGTGATTTGGATGAACTCATCTCTAGA GTCAGAAAGTACACCAAGGATACTCCTTTGGCCGTTGGGTTTGGTGTCTCTACCAGAGAA CATTTCCAATCAGTTGGTAGTGTTGCTGACGGTGTAGTGATTGGTTCCAAAATCGTCACA TTATGTGGAGATGCTCCAGAGGGCAAAAGGTACGACGTTGCTAAGGAATATGTACAGGGA ATTCTAAATGGTGCTAAGCATAAGGTTCTGTCCAAGGACGAATTCTTTGCCTTTCAAAAA GAGTCCTTGAAGTCCGCAAACGTTAAGAAGGAAATACTGGACGAATTTGATGAAAATCAC AAGCACCCAATTAGATTTGGGGACTTTGGTGGTCAGTATGTCCCAGAAGCTCTTCATGCA TGTCTAAGAGAGTTGGAAAAGGGTTTTGATGAAGCTGTCGCCGATCCCACATTCTGGGAA GACTTCAAATCCTTGTATTCTTATATTGGCCGTCCTTCTTCACTACACAAAGCTGAGAGA TTAACTGAGCATTGTCAAGGTGCTCAAATCTGGTTGAAGAGAGAAGATCTTAACCACACG GGATCTCACAAGATCAACAATGCTTTAGCACAAGTTCTTCTAGCTAAAAGATTAGGCAAG AAGAACGTTATTGCTGAAACCGGTGCTGGTCAACACGGTGTTGCCACTGCCACTGCATGT GCTAAATTTGGCTTAACCTGTACTGTGTTCATGGGTGCAGAAGATGTTCGTCGCCAAGCT TTAAACGTCTTCAGAATGAGAATTCTCGGTGCTAAAGTAATTGCTGTTACTAATGGTACA AAGACTCTAAGAGACGCTACTTCAGAGGCATTCAGATTTTGGGTTACTAACTTGAAAACT ACTTACTACGTCGTCGGTTCTGCCATTGGTCCTCACCCATATCCAACTTTGGTTAGAACT TTCCAAAGTGTCATTGGTAAAGAAACCAAGGAACAGTTTGCTGCCATGAACAATGGTAAA TTACCTGACGCAGTTGTTGCATGTGTTGGGGGTGGTTCCAACTCTACAGGTATGTTTTCA CCATTCGAGCATGATACTTCCGTTAAGTTATTGGGTGTGGAAGCCGGTGGTGATGGTGTA GATACAAAGTTCCACTCTGCTACTCTAACTGCCGGTAGACCTGGTGTCTTCCATGGTGTC AAGACTTATGTCTTGCAAGATAGTGATGGTCAAGTCCATGATACTCATTCTGTTTCTGCT GGGTTAGACTACCCAGGTGTCGGTCCAGAATTGGCATATTGGAAATCTACTGGCCGTGCT CAATTCATTGCAGCTACTGACGCTCAGGCTCTGCTTGGCTTTAAATTATTATCTCAATTA GAAGGTATTATTCCCGCTTTGGAATCTTCTCATGCTGTTTATGGCGCTTGCGAATTGGCT AAGACGATGAAGCCTGATCAACATTTGGTTATCAATATTTCTGGTAGAGGTGATAAAGAT GTCCAAAGTGTCGCTGAAGTCTTGCCGAAATTAGGTCCAAAGATAGGTTGGGATTTGAGA TTCGAAGAAGACCCATCTGCCTAA
Protein Properties
Pfam Domain Function
Protein Residues707
Protein Molecular Weight76625.5
Protein Theoretical pI6.47
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Tryptophan synthase MSEQLRQTFANAKKENRNALVTFMTAGYPTVKDTVPILKGFQDGGVDIIELGMPFSDPIA DGPTIQLSNTVALQNGVTLPQTLEMVSQARNEGVTVPIILMGYYNPILNYGEERFIQDAA KAGANGFIIVDLPPEEALKVRNYINDNGLSLIPLVAPSTTDERLELLSHIADSFVYVVSR MGTTGVQSSVASDLDELISRVRKYTKDTPLAVGFGVSTREHFQSVGSVADGVVIGSKIVT LCGDAPEGKRYDVAKEYVQGILNGAKHKVLSKDEFFAFQKESLKSANVKKEILDEFDENH KHPIRFGDFGGQYVPEALHACLRELEKGFDEAVADPTFWEDFKSLYSYIGRPSSLHKAER LTEHCQGAQIWLKREDLNHTGSHKINNALAQVLLAKRLGKKNVIAETGAGQHGVATATAC AKFGLTCTVFMGAEDVRRQALNVFRMRILGAKVIAVTNGTKTLRDATSEAFRFWVTNLKT TYYVVGSAIGPHPYPTLVRTFQSVIGKETKEQFAAMNNGKLPDAVVACVGGGSNSTGMFS PFEHDTSVKLLGVEAGGDGVDTKFHSATLTAGRPGVFHGVKTYVLQDSDGQVHDTHSVSA GLDYPGVGPELAYWKSTGRAQFIAATDAQALLGFKLLSQLEGIIPALESSHAVYGACELA KTMKPDQHLVINISGRGDKDVQSVAEVLPKLGPKIGWDLRFEEDPSA
References
External Links
ResourceLink
Saccharomyces Genome Database TRP5
Uniprot IDP00931
Uniprot NameTRP_YEAST
GenBank Gene IDV01342
Genebank Protein ID4674
General Reference
  • Zalkin, H., Yanofsky, C. (1982). "Yeast gene TRP5: structure, function, regulation." J Biol Chem 257:1491-1500.6276387
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Brosius, J., Walz, A. (1982). "DNA sequences flanking an E. coli insertion element IS2 in a cloned yeast TRP5 gene." Gene 17:223-228.6282714
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956