You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome b-c1 complex subunit 6
Synonyms
  • Complex III subunit 6
  • Complex III subunit VI
  • Cytochrome c1 non-heme 17 kDa protein
  • Mitochondrial hinge protein
  • Ubiquinol-cytochrome c reductase complex 17 kDa protein
Gene NameQCR6
Enzyme ClassNot Available
Biological Properties
General FunctionCoenzyme transport and metabolism
Specific FunctionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. QCR6 may mediate formation of the complex between cytochromes c and c1
Cellular LocationMitochondrion inner membrane
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
ubiquinol-cytochrome-c reductase activity
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
Process
metabolic process
generation of precursor metabolites and energy
cellular metabolic process
electron transport chain
respiratory electron transport chain
mitochondrial electron transport, ubiquinol to cytochrome c
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>444 bp ATGGGCATGTTGGAACTAGTTGGTGAGTACTGGGAACAACTAAAGATAACCGTTGTGCCT GTTGTGGCCGCGGCCGAAGATGACGATAACGAGCAGCATGAAGAAAAGGCAGCAGAAGGA GAAGAAAAAGAAGAAGAAAATGGGGATGAAGATGAGGATGAAGACGAAGACGAAGATGAT GATGATGATGACGACGAAGATGAGGAAGAAGAGGAAGAAGTCACTGATCAGTTGGAAGAT TTGAGAGAACATTTCAAGAACACGGAGGAGGGTAAGGCCCTTGTGCACCACTACGAGGAG TGTGCTGAGAGAGTCAAGATACAGCAACAACAACCCGGCTACGCGGATCTTGAACACAAG GAGGACTGTGTGGAGGAGTTTTTCCATCTACAGCACTATTTGGACACTGCCACGGCACCT AGATTATTTGACAAATTAAAGTAG
Protein Properties
Pfam Domain Function
Protein Residues147
Protein Molecular Weight17257.0
Protein Theoretical pI3.72
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome b-c1 complex subunit 6 MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDD DDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHK EDCVEEFFHLQHYLDTATAPRLFDKLK
References
External Links
ResourceLink
Saccharomyces Genome Database QCR6
Uniprot IDP00127
Uniprot NameQCR6_YEAST
GenBank Gene IDD50617
Genebank Protein ID836788
PDB ID
1P84
General Reference
  • Van Loon, A. P., De Groot, R. J., De Haan, M., Dekker, A., Grivell, L. A. (1984). "The DNA sequence of the nuclear gene coding for the 17-kd subunit VI of the yeast ubiquinol-cytochrome c reductase: a protein with an extremely high content of acidic amino acids." EMBO J 3:1039-1043.6329732
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Eki, T., Naitou, M., Hagiwara, H., Abe, M., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Shibata, T., Watanabe, K., et, a. l. .. (1996). "Fifteen open reading frames in a 30.8 kb region of the right arm of chromosome VI from Saccharomyces cerevisiae." Yeast 12:177-190.8686381
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hunte, C., Koepke, J., Lange, C., Rossmanith, T., Michel, H. (2000). "Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment." Structure 8:669-684.10873857
  • Lange, C., Hunte, C. (2002). "Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c." Proc Natl Acad Sci U S A 99:2800-2805.11880631