Identification |
---|
Name | Cytochrome b-c1 complex subunit 6 |
---|
Synonyms | - Complex III subunit 6
- Complex III subunit VI
- Cytochrome c1 non-heme 17 kDa protein
- Mitochondrial hinge protein
- Ubiquinol-cytochrome c reductase complex 17 kDa protein
|
---|
Gene Name | QCR6 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | Coenzyme transport and metabolism |
---|
Specific Function | Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. QCR6 may mediate formation of the complex between cytochromes c and c1 |
---|
Cellular Location | Mitochondrion inner membrane |
---|
SMPDB Pathways | Not Available |
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | |
---|
GO Classification | Function |
---|
transporter activity | transmembrane transporter activity | substrate-specific transmembrane transporter activity | ion transmembrane transporter activity | cation transmembrane transporter activity | inorganic cation transmembrane transporter activity | monovalent inorganic cation transmembrane transporter activity | hydrogen ion transmembrane transporter activity | ubiquinol-cytochrome-c reductase activity | Process |
---|
metabolic process | cellular metabolic process | generation of precursor metabolites and energy | electron transport chain | respiratory electron transport chain | mitochondrial electron transport, ubiquinol to cytochrome c |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | >444 bp
ATGGGCATGTTGGAACTAGTTGGTGAGTACTGGGAACAACTAAAGATAACCGTTGTGCCT
GTTGTGGCCGCGGCCGAAGATGACGATAACGAGCAGCATGAAGAAAAGGCAGCAGAAGGA
GAAGAAAAAGAAGAAGAAAATGGGGATGAAGATGAGGATGAAGACGAAGACGAAGATGAT
GATGATGATGACGACGAAGATGAGGAAGAAGAGGAAGAAGTCACTGATCAGTTGGAAGAT
TTGAGAGAACATTTCAAGAACACGGAGGAGGGTAAGGCCCTTGTGCACCACTACGAGGAG
TGTGCTGAGAGAGTCAAGATACAGCAACAACAACCCGGCTACGCGGATCTTGAACACAAG
GAGGACTGTGTGGAGGAGTTTTTCCATCTACAGCACTATTTGGACACTGCCACGGCACCT
AGATTATTTGACAAATTAAAGTAG |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 147 |
---|
Protein Molecular Weight | 17257.0 |
---|
Protein Theoretical pI | 3.72 |
---|
PDB File | show |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >Cytochrome b-c1 complex subunit 6
MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDD
DDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHK
EDCVEEFFHLQHYLDTATAPRLFDKLK |
---|
References |
---|
External Links | |
---|
General Reference | - Van Loon, A. P., De Groot, R. J., De Haan, M., Dekker, A., Grivell, L. A. (1984). "The DNA sequence of the nuclear gene coding for the 17-kd subunit VI of the yeast ubiquinol-cytochrome c reductase: a protein with an extremely high content of acidic amino acids." EMBO J 3:1039-1043.6329732
- Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
- Eki, T., Naitou, M., Hagiwara, H., Abe, M., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Shibata, T., Watanabe, K., et, a. l. .. (1996). "Fifteen open reading frames in a 30.8 kb region of the right arm of chromosome VI from Saccharomyces cerevisiae." Yeast 12:177-190.8686381
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
- Hunte, C., Koepke, J., Lange, C., Rossmanith, T., Michel, H. (2000). "Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment." Structure 8:669-684.10873857
- Lange, C., Hunte, C. (2002). "Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c." Proc Natl Acad Sci U S A 99:2800-2805.11880631
|
---|