You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIMP-specific 5'-nucleotidase 1
SynonymsNot Available
Gene NameISN1
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionIMP-specific 5'-nucleotidase involved in IMP (inositol monophosphate) degradation
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Inosinic acid + waterphosphate + Inosine
Metabolites
YMDB IDNameView
YMDB00352Inosinic acidShow
YMDB00510InosineShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
ion binding
catalytic activity
cation binding
metal ion binding
hydrolase activity
magnesium ion binding
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR155C
Gene Sequence>1353 bp ATGTCCTCAAGATATAGAGTGGAATATCATTTGAAGAGCCACCGCAAGGATGAGTTTATA GATTGGGTAAAGGGGCTACTGGCCTCACCTTTTGTTCTACATGCCGTCTCTCATGAAGGT GACTACAATGACGACTTAGCAACAACTCAACGTGTAAGGTCGCAGTATGCTGATATCTTT AAAGACATTGAAGGGCTGATTAAAGATAAAATAGAATTTGACTCAAGAAACATGAGCCAA GACGAAATTGAAGATGGCGCCTCTTCTCAATCTCTGAATATATTAGGACAATCGCGTTTA AATCTTTTGGTTCCATCAATTGGAACATTCTTTACGGAACTTCCATTGGAACAAGCTTTT CTATGGGAAGACTCACAACGGGCCATTTCGGCGCGTAGAATGGTAGCACCCAGTTTTAAT GATATCAGGCATATCCTGAATACTGCACAGATATTTCACTTTAAGAAACAGGAGAACTTA CATAATGGTAAGGTTTTGAGATTAGTGACTTTTGATGGAGATGTGACGCTGTATGAAGAT GGTGGCTCCCTGGTTTACACTAATCCTGTAATTCCTTATATTCTCAAGCTGTTGCGGTGC GGTATCAATGTGGGAATAGTCACTGCGGCCGGATATGATGAAGCTGGAACCTATGAGAAC AGATTGAAAGGATTAATTGTTGCATTACATGATTCAACTGATATACCAGTTTCTCAAAAG CAGAATTTAACAATAATGGGTGGTGAGTCGAGTTACCTTTTCCGTTACTATGAAGACCCG GAGGAAGATAACTTTGGCTTTAGACAAATTGACAAAGAGGAATGGCTATTGCCTAGAATG AAGGCTTGGTCCCTCGAGGACGTGGAAAAGACTTTGGACTTTGCCGAGAGAACTCTTAAC AGGTTAAGAAAAAGACTAAACCTACCTTCAGAGATTTCTATTATCCGTAAAGTCAGGGCA GTGGGTATCGTCCCAGGCGAACGGTACGATGAAGCTTCTAAAAGACAAGTTCCTGTTAAG CTTGATAGGGAACAACTGGAGGAAATAGTTTTAACCCTTCAAAACACTTTAGAGTCTTTT GCCCCATCTAGAAGAATTCAATTTAGTTGTTTTGATGGTGGTAGTGATGTCTGGTGTGAT ATTGGGGGGAAAGATCTTGGTGTTCGTTCATTGCAACAATTTTATAACCCTGAATCTCCT ATCCAACCCTCTGAAACCTTACACGTAGGCGATCAGTTTGCACCGGTGGGATCAGCAAAT GATTTTAAGGCAAGGCTAGCTGGATGTACCCTCTGGATAGCATCCCCTCAAGAAACAGTG AATTATCTTCATAGATTATTAGAAACTGATTAA
Protein Properties
Pfam Domain Function
Protein Residues450
Protein Molecular Weight51329.5
Protein Theoretical pI5.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>IMP-specific 5'-nucleotidase 1 MSSRYRVEYHLKSHRKDEFIDWVKGLLASPFVLHAVSHEGDYNDDLATTQRVRSQYADIF KDIEGLIKDKIEFDSRNMSQDEIEDGASSQSLNILGQSRLNLLVPSIGTFFTELPLEQAF LWEDSQRAISARRMVAPSFNDIRHILNTAQIFHFKKQENLHNGKVLRLVTFDGDVTLYED GGSLVYTNPVIPYILKLLRCGINVGIVTAAGYDEAGTYENRLKGLIVALHDSTDIPVSQK QNLTIMGGESSYLFRYYEDPEEDNFGFRQIDKEEWLLPRMKAWSLEDVEKTLDFAERTLN RLRKRLNLPSEISIIRKVRAVGIVPGERYDEASKRQVPVKLDREQLEEIVLTLQNTLESF APSRRIQFSCFDGGSDVWCDIGGKDLGVRSLQQFYNPESPIQPSETLHVGDQFAPVGSAN DFKARLAGCTLWIASPQETVNYLHRLLETD
References
External Links
ResourceLink
Saccharomyces Genome Database ISN1
Uniprot IDQ99312
Uniprot NameISN1_YEAST
GenBank Gene IDZ75063
Genebank Protein ID1420387
General Reference
  • Bordonne, R., Camasses, A., Madania, A., Poch, O., Tarassov, I., Winsor, B., Martin, R. (1997). "Analysis of a 35.6 kb region on the right arm of Saccharomyces cerevisiae chromosome XV." Yeast 13:73-83.9046089
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Itoh, R. (1994). "Purification and some properties of an IMP-specific 5'-nucleotidase from yeast." Biochem J 298 Pt 3:593-598.8141771
  • Itoh, R., Saint-Marc, C., Chaignepain, S., Katahira, R., Schmitter, J. M., Daignan-Fornier, B. (2003). "The yeast ISN1 (YOR155c) gene encodes a new type of IMP-specific 5'-nucleotidase." BMC Biochem 4:4.12735798
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956