You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNa(+)/H(+) antiporter
SynonymsNot Available
Gene NameNHA1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in sodium:hydrogen antiporter activity
Specific FunctionSodium export from cell, takes up external protons in exchange for internal sodium ions
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00020SodiumShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
monovalent inorganic cation transmembrane transporter activity
transmembrane transporter activity
hydrogen ion transmembrane transporter activity
solute:cation antiporter activity
substrate-specific transmembrane transporter activity
solute:hydrogen antiporter activity
ion transmembrane transporter activity
monovalent cation:hydrogen antiporter activity
sodium:hydrogen antiporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
Process
transmembrane transport
monovalent inorganic cation transport
establishment of localization
sodium ion transport
transport
ion transport
cation transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLR138W
Gene Sequence>2958 bp ATGGCTATCTGGGAGCAACTAGAAGTCTCAAAGGCGCACGTTGCTTATGCATGTGTTGGT GTCTTTTCATCTATCTTCTCTTTAGTGTCACTTTATGTCAAGGAGAAGCTTTATATTGGT GAGTCCACCGTAGCAGGTATATTTGGGCTAATTGTGGGTCCTGTTTGCTTGAACTGGTTT AATCCTCTGAAATGGGGGAATTCAGACAGTATAACATTAGAGATAACGAGAATAGTATTA TGTTTGCAAATTTTTGCCGTTGCCGTGGAACTGCCACGGAAATATATGTTGAAGCATTGG GTATCTGTGACGATGCTATTATTGCCAGTGATGACAGCTGGATGGCTTATTATTGGTCTC TTCGTTTGGATTCTTATACCTGGCTTGAATTTTTCTGCTAGTTTGTTGATATCTGCGTGC ATTACCGCAACAGATCCTATTCTGGCGCAGTCGGTCGTCTCCGGTAAGTTTGCCCAAAGA GTACCTGGTCACTTAAGAAATCTACTGTCTGCAGAGTCAGGCTGCAATGATGGTATGGCC TTTCCTTTTTTATTTCTTTCTATGAATTTAATCCTACATCCCGGTAATGGAAGAGAAATT GTCAAAGATTGGATTTGCGTTACTATCCTGTATGAGTGTTTGTTTGGATGCTTGCTAGGT TGCTTCATTGGTTATGTAGGCAGAATCACCATCAGGTTTGCCGAAAAGAAAAACATTATC GATCGTGAGTCGTTCTTAGCATTTTACGTTGTCCTGGCGTTCATGTGTGCTGGGTTCGGC TCCATTTTGGGTGTGGATGACCTATTGGTATCATTTGCAGCCGGTGCGACTTTCGCTTGG GATGGGTGGTTTTCTCAAAAGACACAAGAAAGTAATGTTTCTACCGTGATTGATTTGCTA CTAAACTATGCGTATTTTATCTATTTTGGTGCCATTATACCTTGGAGTCAATTCAACAAC GGTGAAATTGGCACAAACGTCTGGCGTTTAATTATACTTTCGATAGTGGTCATCTTTTTA CGTAGGATCCCTGCAGTCATGATATTAAGACCTCTTATACCTGATATAAAATCGTGGCGT GAGGCACTTTTTGTGGGCCATTTTGGTCCTATTGGTGTAGGTGCAATTTTTGCCGCTATA CTAGCTCGTGGAGAATTAGAGTCTACCTTTAGTGACGAACCCACTCCTTTAAATGTTGTA CCATCAAAAGAGGAAAGTAAACATTGGCAGCTGATAGCCTGTATATGGCCAATAACTTGT TTTTTCATTGTTACTTCTATCATAGTTCATGGTTCTTCAGTTGCAATCATAACTCTAGGT CGTCATTTGAACACGATAACGTTAACCAAAACATTCACTACACACACCACCAATGGTGAT AATGGGAAAAGTTCATGGATGCAAAGGTTGCCATCGTTGGATAAAGCTGGACGATCATTT TCATTGCATCGTATGGATACTCAAATGACTTTATCAGGGGATGAAGGTGAAGCAGAAGAA GGAGGAGGTCGTAAGGGACTAGCAGGAGGTGAAGATGAAGAAGGATTAAACAATGATCAA ATTGGTAGCGTCGCAACGAGCGGAATTCCTGCAAGACCCGCTGGTGGTATGCCAAGGAGG AGGAAATTGTCAAGAAAAGAGAAAAGATTGAACAGAAGACAGAAACTGAGAAACAAAGGT AGAGAAATATTTTCATCAAGATCTAAAAATGAAATGTATGATGACGATGAGTTGAATGAT CTGGGACGAGAAAGGTTGCAAAAAGAAAAGGAAGCACGCGCCGCCACATTTGCATTGAGC ACAGCCGTCAATACACAACGTAATGAGGAGATTGGAATGGGTGGAGATGAAGAAGAAGAT GAGTACACACCGGAAAAGGAATATAGCGATAATTACAATAACACACCAAGTTTTGAGTCG TCTGAAAGATCTTCATCTCTCCGAGGAAGAACTTACGTACCAAGAAACCGTTACGATGGA GAAGAGACAGAAAGCGAGATTGAAAGCGAAGACGAGATGGAAAATGAAAGTGAAAGATCA ATGGCCAGTAGTGAAGAGAGGAGAATTCGAAAAATGAAAGAGGAAGAAATGAAACCTGGT ACTGCTTATTTAGATGGTAATAGAATGATTATTGAAAATAAGCAAGGTGAAATCTTGAAT CAAGTAGATATCGAGGATCGCAATGAGGCGAGAGATGACGAAGTTAGTGTTGATAGTACA GCCCATTCAAGTTTAACTACCACAATGACCAATCTATCCAGTAGTAGTGGGGGAAGGTTA AAGAGAATTTTAACTCCCACATCTTTAGGAAAGATACATTCATTGGTTGATAAAGGAAAG GATAAAAATAAAAACAGCAAGTATCATGCATTTAAAATAGACAATCTGTTAATCATCGAG AATGAGGACGGTGATGTTATAAAAAGATACAAGATAAATCCTCATAAATCTGATGATGAT AAAAGTAAAAACCGCCCAAGAAACGATAGTGTTGTATCAAGAGCTTTAACAGCAGTAGGA CTAAAGAGCAAAGCGAACAGCGGCGTACCGCCTCCAGTAGATGAAGAAAAAGCCATCGAA GGACCCTCCAGGAAGGGCCCAGGGATGTTAAAGAAAAGGACATTAACACCTGCGCCACCG AGAGGAGTTCAAGATTCCTTAGATCTGGAAGATGAACCTTCATCTGAGGAGGATTTAGGT GATAGTTATAACATGGACGATAGTGAAGATTACGACGATAATGCATATGAATCAGAAACT GAATTCGAAAGACAAAGAAGGTTAAATGCGTTAGGTGAGATGACGGCACCAGCGGATCAA GATGACGAAGAGTTGCCGCCCTTACCTGTGGAGGCACAAACAGGAAACGATGGTCCAGGT ACAGCGGAAGGAAAAAAAAAGCAAAAGAGTGCTGCTGTTAAGTCGGCGCTATCAAAAACG CTTGGTCTCAATAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues985
Protein Molecular Weight109368.0
Protein Theoretical pI5.16
Signalling Regions
  • None
Transmembrane Regions
  • 13-33
  • 37-57
  • 71-91
  • 106-126
  • 129-149
  • 177-197
  • 204-224
  • 245-265
  • 295-315
  • 320-340
  • 362-382
  • 411-431
Protein Sequence>Na(+)/H(+) antiporter MAIWEQLEVSKAHVAYACVGVFSSIFSLVSLYVKEKLYIGESTVAGIFGLIVGPVCLNWF NPLKWGNSDSITLEITRIVLCLQIFAVAVELPRKYMLKHWVSVTMLLLPVMTAGWLIIGL FVWILIPGLNFSASLLISACITATDPILAQSVVSGKFAQRVPGHLRNLLSAESGCNDGMA FPFLFLSMNLILHPGNGREIVKDWICVTILYECLFGCLLGCFIGYVGRITIRFAEKKNII DRESFLAFYVVLAFMCAGFGSILGVDDLLVSFAAGATFAWDGWFSQKTQESNVSTVIDLL LNYAYFIYFGAIIPWSQFNNGEIGTNVWRLIILSIVVIFLRRIPAVMILRPLIPDIKSWR EALFVGHFGPIGVGAIFAAILARGELESTFSDEPTPLNVVPSKEESKHWQLIACIWPITC FFIVTSIIVHGSSVAIITLGRHLNTITLTKTFTTHTTNGDNGKSSWMQRLPSLDKAGRSF SLHRMDTQMTLSGDEGEAEEGGGRKGLAGGEDEEGLNNDQIGSVATSGIPARPAGGMPRR RKLSRKEKRLNRRQKLRNKGREIFSSRSKNEMYDDDELNDLGRERLQKEKEARAATFALS TAVNTQRNEEIGMGGDEEEDEYTPEKEYSDNYNNTPSFESSERSSSLRGRTYVPRNRYDG EETESEIESEDEMENESERSMASSEERRIRKMKEEEMKPGTAYLDGNRMIIENKQGEILN QVDIEDRNEARDDEVSVDSTAHSSLTTTMTNLSSSSGGRLKRILTPTSLGKIHSLVDKGK DKNKNSKYHAFKIDNLLIIENEDGDVIKRYKINPHKSDDDKSKNRPRNDSVVSRALTAVG LKSKANSGVPPPVDEEKAIEGPSRKGPGMLKKRTLTPAPPRGVQDSLDLEDEPSSEEDLG DSYNMDDSEDYDDNAYESETEFERQRRLNALGEMTAPADQDDEELPPLPVEAQTGNDGPG TAEGKKKQKSAAVKSALSKTLGLNK
References
External Links
ResourceLink
Saccharomyces Genome Database NHA1
Uniprot IDQ99271
Uniprot NameNAH1_YEAST
GenBank Gene IDU53881
Genebank Protein ID1256899
General Reference
  • Prior, C., Potier, S., Souciet, J. L., Sychrova, H. (1996). "Characterization of the NHA1 gene encoding a Na+/H+-antiporter of the yeast Saccharomyces cerevisiae." FEBS Lett 387:89-93.8654575
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956