You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3,4-dihydroxy-2-butanone 4-phosphate synthase
Synonyms
  • DHBP synthase
Gene NameRIB3
Enzyme Class
Biological Properties
General FunctionInvolved in 3,4-dihydroxy-2-butanone-4-phosphate synthase activity
Specific FunctionCatalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate
Cellular LocationNot Available
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
D-ribulose 5-phosphateFormic acid + 2-Hydroxy-3-oxobutyl phosphate
KEGG Reactions
D-ribulose 5-phosphateFormic acid + 2-Hydroxy-3-oxobutyl phosphate + hydron
Metabolites
YMDB IDNameView
YMDB00208(2S)-2-Hydroxy-3-oxobutyl phosphateShow
YMDB00385Formic acidShow
YMDB004562-Hydroxy-3-oxobutyl phosphateShow
YMDB00862hydronShow
YMDB00948D-ribulose 5-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
lyase activity
carbon-carbon lyase activity
3,4-dihydroxy-2-butanone-4-phosphate synthase activity
Process
metabolic process
nitrogen compound metabolic process
riboflavin metabolic process
riboflavin biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR487C
Gene Sequence>627 bp ATGTTTACACCAATTGATCAAGCTATAGAACACTTCAAGCAGAATAAGTTTGTAATTGTT ATGGACGATGCCGGTCGTGAAAATGAAGGTGATCTTATTTGCGCTGCTGAAAATGTCAGC ACTGAACAAATGGCCTTTCTTGTACGCCATTCCTCAGGCTACGTCTGTGCACCTATGACG AATGCCATTGCTGATAAGTTGGACCTTCCACTACTGAGAACAGGCATGAAGTTTGAATCC AATGATGACGACAGGCATGGAACTGCATACACAATAACTGTAGATGTAGCCCAAGGCACT ACCACAGGTATTTCTGCTCACGACAGGTCGATGACTTGTAGGGCTCTTGCAGACTCTTCC TCTACGCCAAAATCATTTTTAAAACCAGGGCACATCTGTCCCTTGAGAGCCGCTGATGGC GGTGTTTTGCAGAGAAGAGGCCACACTGAGGCCGGTGTCGATTTGTGTAAACTAAGTGGA CTAAGTCCCGTCGCTGTTATTGGCGAATTGGTTAACGATGACGAACAAGGAACTATGATG AGATTAAATGACTGCCAAGCGTTTGGTAAGAAACATGGCATTCCTTTGATCTCCATCGAA GAATTGGCCCAATATTTGAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues208
Protein Molecular Weight22567.40039
Protein Theoretical pI5.57
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3,4-dihydroxy-2-butanone 4-phosphate synthase MFTPIDQAIEHFKQNKFVIVMDDAGRENEGDLICAAENVSTEQMAFLVRHSSGYVCAPMT NAIADKLDLPLLRTGMKFESNDDDRHGTAYTITVDVAQGTTTGISAHDRSMTCRALADSS STPKSFLKPGHICPLRAADGGVLQRRGHTEAGVDLCKLSGLSPVAVIGELVNDDEQGTMM RLNDCQAFGKKHGIPLISIEELAQYLKK
References
External Links
ResourceLink
Saccharomyces Genome Database RIB3
Uniprot IDQ99258
Uniprot NameRIB3_YEAST
GenBank Gene IDAY557810
Genebank Protein ID45269511
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356