You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable cation-transporting ATPase 2
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + H(2)O = ADP + phosphate
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
ATPase activity, coupled to transmembrane movement of ions
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
binding
hydrolase activity, acting on acid anhydrides
nucleoside binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
catalytic activity
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
transporter activity
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
transmembrane transporter activity
pyrophosphatase activity
nucleoside-triphosphatase activity
ATPase activity
hydrolase activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
cation transport
metabolic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
establishment of localization
nitrogen compound metabolic process
transport
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
ion transport
Gene Properties
Chromosome LocationNot Available
LocusYOR291W
Gene Sequence>4419 bp ATGGATATTCCCTCTTCAAACCAAATTCAACATGGCCAAAGGAGTGAAAGGAACCGAAGA ATGCCGAGGGCTTCTTTTTCTTCTACAGCCACTACTTCTACGGCGGCCACATTGACTTCC GCGATGGTACTGGATCAGAACAATTCGGAACCGTACGCAGGTGCAACATTCGAAGCCGTG CCAAGTTCTATTGTATCATTCCATCACCCTCATTCTTTTCAATCAAGCAACCTCCCAAGT CCGCATTCTTCAGGGAACCTAGAGCAGAGAGGCCGCCGATTGACTGAATCAGAGCCTTTA GTATTATCCTCGGCTGAACAGTCTCGAAGCTCTTCTAGAAACCCTTCTCATTTTCGATTT TTCACTCAGGAGCAAATATCCAATGCTGAAGGCGCTTCCACGTTAGAAAATACAGATTAT GACATGGCCTGGGATGCCACCCCCGCTTATGAACAAGATAGAATCTATGGTACGGGCCTA TCTTCCAGGCGTTCTTCTATTCGAAGTTTTTCCAGAGCATCATCTCTCTCAAATGCAAAG TCTTATGGATCTTTCAGTAAGAGGGGTCGCTCTGGTTCAAGGGCACCACAAAGGCTGGGA GAAAATTCTGACACTGGGTTCGTTTATCATTCCGCTACACATTCATCATCCAGTTTATCG AGATATACGACCAGAGAAAGAATTCCTATTGAACTAGAAAGTCAAACAGATGAAATACTA GAAGACGAGTCTTCTACACATTCTTTAGAATCTTCAGATAGTAGGCGATCTGCAAGCGAA AATAATAGAGGAAGCTTTTCTGGTCATGATGATGTTCATAATCAGCATAGCGAATATCTA AAACCTGACTATCATGAAAAGTTTTATCCACAGTATGCACCAAACTTGCATTACCAAAGG TTTTACATTGCGGAAGAGGATTTAGTTATTGGTATCGCTGCTTACCAGACCTCAAAATTC TGGTATATTATTTACAACCTGTGCTGCTTCTTGACTTTCGGATTAGTTTATCTTTTAACG AGATGGCTTCCCCATCTCAAAGTTAAATTATATGGCGTGAAAGTGCCATTGGCTAAAGCA GAATGGGTCGTGATAGAAAATGAGTTTGGTGAGTTTGTCATACAACCTATCGATCGACAG TGGTATAATAGACCATTAAGTACTGTTTTACCTTTTGAAAATTACCCTAATCCGTCATAT GAACCAAATGATATCAATTTGAGCCACCACCATGCCAATGAAATTAATCCAAATGTGCCT ATCTTGATCACATTTGAATACAGATATATTAAGTTCATATATTCACCGCTCGATGATCTC TTTAAAACTAACAATAACTGGATAGATCCTGACTGGGTGGATTTAAGTACCGTATCAAAT GGTTTAACTAAGGGGGTTCAAGAAGATAGAGAACTTGCGTTTGGTAAAAATCAAATTAAT TTGAGAATGAAAACTACTTCAGAAATTTTATTCAATGAAGTGTTGCATCCGTTTTATGTC TTTCAAGTATTTTCGATAATTTTGTGGGGCATTGATGAATACTACTACTACGCCGCATGC ATTTTTTTGATTTCTGTACTGTCTATTTTTGATTCATTGAATGAACAGAAGAAAGTATCG AGAAACTTAGCTGAAATGTCGCACTTTCATTGTGACGTTCGTGTTTTGAGGGATAAGTTT TGGACAACGATAAGCTCATCAGAACTAGTTCCGGGCGATATATATGAAGTATCTGACCCA AATATAACAATATTGCCTTGTGACTCTATTCTTCTGTCCAGTGATTGTATAGTCAATGAA TCCATGCTAACTGGTGAATCTGTGCCCGTTTCGAAATTTCCAGCTACGGAAGAAACAATG TACCAATTATGTGACGACTTCCAGAGCACCCAAATATCGAGTTTTGTTTCCAAATCCTTC TTGTATAATGGTACAAATATAATTAGAGCAAGAATTGCCCCCGGGCAAACCGCCGCTTTG GCGATGGTTGTAAGGACAGGATTCTCAACAACAAAGGGCTCCTTGGTTCGTTCCATGGTT TTCCCAAAACCAACTGGTTTTAAATTCTATAGAGATTCCTTTAAATATATTGGATTCATG TCATTAATCGCAATTTTCGGTTTTTGCGTCAGTTGCGTTCAGTTCATTAAACTTGGTTTA GACAAAAAGACAATGATATTAAGAGCTTTAGATATCATAACAATTGTAGTGCCACCAGCT CTGCCCGCGACTTTAACCATTGGTACCAATTTTGCTTTGAGTAGGTTAAAGGAGAAGGGA ATATTTTGTATCTCTCCAACAAGGCTTAACATTAGTGGTAAAATCGATGTTATGTGTTTT GATAAAACTGGAACACTTACCGAAGATGGCTTAGATGTACTTGGAGTACAAATATCGGAG CCAAATGGGGTTAGAGGCCAGAAGTTTGGAGAACTATTGAGTGATATTCGCCAAGTATTT CCTAAATTTTCTTTGAACGATTGTAGTTCGCCATTAGATTTTAAGTCCAGGAACTTTTTC ATGTCATTATTAACATGTCACTCGCTGAGATCAGTTGATGGAAATTTACTCGGTGACCCA CTAGACTTTAAAATGTTTCAATTTACCGGTTGGTCATTCGAGGAGGACTTCCAAAAACGA GCATTCCATTCATTATACGAGGGAAGACATGAAGATGATGTTTTCCCAGAAAATTCAGAA ATCATTCCTGCGGTAGTTCACCCTGATAGTAATAATAGAGAAAATACGTTTACTGATAAT GATCCTCATAATTTTCTAGGGGTGGTGAGAAGCTTTGAATTTTTATCTGAGCTGAGACGT ATGAGCGTAATTGTTAAAACGAATAATGACGACGTATATTGGTCGTTTACTAAAGGTGCG CCCGAAGTTATTTCAGAAATATGTAATAAATCAACTTTACCTGCAGATTTTGAAGAAGTA CTACGTTGTTACACTCATAACGGATATAGGGTTATTGCATGTGCTGGGAAGACACTTCCA AAAAGAACTTGGTTATATTCCCAAAAAGTATCTAGGGAAGAGGTTGAGTCAAATTTGGAA TTTTTAGGTTTCATTATCTTCCAAAATAAACTAAAAAAAGAGACCTCTGAAACTCTGAAA AGTTTACAAGATGCAAACATCAGGACGATAATGTGTACGGGTGATAACATACTTACTGCT ATTTCCGTAGGTAGGGAAGCTGGTTTGATACAATGCTCTCGCGTTTATGTTCCATCCATT AATGATACACCCTTGCACGGTGAGCCCGTAATAGTATGGAGGGACGTCAATGAGCCAGAT AAAATTTTGGATACCAAGACTTTGAAACCTGTCAAGCTGGGGAATAATAGTGTTGAAAGT CTACGTGAGTGTAACTATACTCTTGCAGTTAGCGGCGATGTATTTAGACTGTTGTTCAGA GATGAAAACGAGATACCAGAGGAATACTTAAACGAGATTTTATTGAATTCATCAATCTAC GCAAGAATGTCGCCTGATGAAAAGCATGAATTGATGATACAGCTGCAGAAGCTAGATTAT ACAGTTGGGTTCTGTGGTGATGGTGCAAATGATTGTGGGGCACTCAAAGCGGCAGACGTA GGTATTTCCCTTTCGGAGGCTGAAGCTTCAGTTGCTGCTCCGTTCACTTCAAAGATATTT AATATTAGCTGCGTACTTGATGTCATTAGGGAAGGGCGTGCTGCGTTAGTTACATCTTTT GCATGTTTCCAGTACATGAGTTTGTACTCTGCCATCCAATTCATCACTATTACTATACTT TACAGCCGTGGTTCTAATTTGGGAGATTTCCAATTCCTGTACATTGATTTATTGCTGATC GTTCCGATCGCAATTTGCATGTCATGGTCCAAATCCTATGAAAAGATAGATAAAAAGAGG CCTTCCGCTAACCTAGTTTCACCTAAGATTTTGGTTCCTCTTTTGATTAGCGTATTCTTG GTGTTTTTATTCCAGTTCATTCCATGGATAATCGTACAAAAGATGAGCTGGTACATCAAG CCAATCGTTGGGGGCGACGACGCCGTGCAATCTTCAGATAATACCGTATTGTTCTTCGTC TCAAATTTTCAATATATTTTGACTGCTATAGTTTTGTCTGTGGGTCCACCATATAGAGAG CCGATGTCAAAAAACTTTGAATTTATCGTTGATATCACTGTCTCTATCGGTGCAAGTCTA CTGCTAATGACTTTGGATACAGAATCATACCTTGGTAAGATGTTACAGCTGACCCCTATA TCAAACAGTTTTACAATGTTTATCATTGTATGGGTGATATTAAATTACTATGCTCAACTG TATATACCGCCATCGATAAAAGGTTGGTTAAAGAAAAAGAAGAGTAGCAAAAAGTATAAA CTACTGATACAAGAAGAAATGAAATTAAAAGAAGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues1472
Protein Molecular Weight166748.0
Protein Theoretical pI6.04
Signalling Regions
  • None
Transmembrane Regions
  • 294-315
  • 322-344
  • 489-511
  • 515-533
  • 694-713
  • 727-748
  • 1245-1264
  • 1272-1289
  • 1308-1331
  • 1352-1374
  • 1388-1407
  • 1424-1446
Protein Sequence>Probable cation-transporting ATPase 2 MDIPSSNQIQHGQRSERNRRMPRASFSSTATTSTAATLTSAMVLDQNNSEPYAGATFEAV PSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVLSSAEQSRSSSRNPSHFRF FTQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGTGLSSRRSSIRSFSRASSLSNAK SYGSFSKRGRSGSRAPQRLGENSDTGFVYHSATHSSSSLSRYTTRERIPIELESQTDEIL EDESSTHSLESSDSRRSASENNRGSFSGHDDVHNQHSEYLKPDYHEKFYPQYAPNLHYQR FYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKA EWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVP ILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQIN LRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVS RNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNE SMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAAL AMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGL DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCF DKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFF MSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSE IIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGA PEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLE FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFR DENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADV GISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITIL YSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFL VFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYRE PMSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQL YIPPSIKGWLKKKKSSKKYKLLIQEEMKLKEV
References
External Links
ResourceLink
Saccharomyces Genome Database YOR291W
Uniprot IDQ12697
Uniprot NameATC9_YEAST
GenBank Gene IDZ75199
Genebank Protein ID1420646
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956