You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSodium transport ATPase 5
SynonymsNot Available
Gene NameENA5
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of sodium or lithium ions to allow salt tolerance
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00020SodiumShow
YMDB00109Adenosine triphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
hydrolase activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
ATPase activity, coupled to transmembrane movement of ions
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
binding
hydrolase activity, acting on acid anhydrides
nucleoside binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
catalytic activity
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
transporter activity
transmembrane transporter activity
Process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
ion transport
purine nucleotide metabolic process
purine nucleotide biosynthetic process
cation transport
metabolic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
establishment of localization
nitrogen compound metabolic process
transport
cellular nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR038C
Gene Sequence>3276 bp ATGAGCGAGGGAACTGTCAAAGAAAACAATAATGAAGAATTCAATGCTTATCACACATTG ACTACAGAAGAAGCCGCTGAATTTATAGGCACAAGTCTGACTGAAGGTCTTACTCAAGAT GAGTCCCTCCGCAGACTGAAAGCAGTGGGAGAGAACACATTGGGTGATGATACCAAAATT GACTATAAAGCAATGGTCCTCCATCAGGTATGTAATGCAATGATTATGGTCTTGGTAATA TCCATGGCGATCTCTTTCGCTGTGCGCGACTGGATTACTGGTGGCGTTATTTCTTTTGTT ATCGCGGTCAATGTGCTCATTGGCCTAGTTCAAGAATATAAGGCTACCAAGACAATGAAC TCTTTGAAAAACTTGAGCTCTCCCAATGCTCATGTTATTAGGAACGGGAAAAGTGAGACT ATAAACTCAAAAGATGTGGTTCCAGGTGATATTTGTCTGGTGAAGGTCGGTGATACTATT CCTGCTGATTTGCGTTTAATTGAAACTAAGAATTTTGATACTGATGAATCACTACTGACC GGTGAATCTTTGCCTGTCTCCAAAGACGCCAACTTAGTGTTTGGAAAAGAAGAAGAAACC TCCGTGGGTGATCGTTTGAATTTAGCATTTTCTTCATCCGCCGTTGTCAAGGGAAGAGCC AAGGGTATTGTCATCAAGACAGCTTTGAATAGTGAAATTGGTAAAATTGCAAAATCTCTA CAAGGTGATTCAGGTCTCATTTCCCGCGATCCTAGTAAGTCGTGGTTACAGAATACATGG ATATCTACAAAGAAAGTTACTGGTGCATTTTTAGGTACAAATGTCGGTACGCCCCTGCAC AGGAAACTGTCTAAGTTGGCGGTATTGCTTTTCTGGATTGCCGTACTTTTTGCTATCATC GTCATGGCCTCTCAAAAGTTTGACGTAGATAAAAGGGTAGCTATCTATGCCATTTGTGTG GCCCTATCCATGATTCCCTCTTCATTAGTCGTTGTCTTGACCATCACCATGTCTGTTGGG GCTGCTGTTATGGTTTCTAGAAACGTTATTGTAAGAAAATTAGATTCTCTGGAAGCTTTA GGTGCCGTTAACGATATCTGTTCTGACAAGACCGGTACTCTTACACAGGGTAAAATGTTA GCGAGGCAAATTTGGATCCCTCGCTTTGGTACCATAACTATCTCGAATTCTGATGACCCC TTTAATCCCAATGAGGGCAACGTGAGTTTGATTCCAAGGTTTTCACCTTACGAATATTCT CATAATGAGGATGGTGACGTTGGTATTCTCCAGAATTTCAAGGATCGCCTATACGAAAAA GATTTACCAGAAGATATTGACATGGATCTATTTCAAAAATGGCTCGAAACCGCCACTTTG GCTAACATTGCTACTGTTTTCAAAGATGACGCAACTGACTGTTGGAAAGCTCATGGTGAC CCAACAGAAATTGCGATTCAAGTGTTTGCTACTAAGATGGACTTGCCTCACAATGCCCTT ACCGGTGAGAAATCGACTAATCAAAGTAATGAGAATGACCAATCCTCTCTTTCACAACAC AATGAGAAGCCTGGCAGTGCACAATTCGAACATATTGCTGAATTCCCATTCGACTCAACT GTGAAGCGAATGTCATCTGTCTACTACAACAATCACAACGAAACATATAATATTTATGGC AAGGGTGCTTTCGAAAGCATCATCAGTTGTTGCAGTTCTTGGTATGGTAAGGATGGTGTA AAAATCACACCATTGACCGATTGTGATGTCGAAACGATAAGGAAAAATGTTTACAGTCTA TCAAATGAGGGTTTAAGAGTCTTGGGTTTTGCCTCCAAATCTTTCACTAAAGATCAAGTG AATGACGATCAATTGAAAAACATTACTTCAAACAGGGCCACCGCAGAAAGTGATTTAGTT TTCCTAGGGTTGATTGGTATTTACGATCCACCCAGAAATGAGACTGCCGGTGCAGTCAAG AAGTTTCACCAAGCTGGTATTAACGTTCATATGTTAACTGGGGACTTTGTGGGTACAGCA AAGGCTATCGCTCAGGAGGTTGGCATCTTACCCACCAATTTGTACCATTACTCCCAAGAG ATTGTTGACAGTATGGTCATGACCGGATCTCAGTTTGACGGACTAAGTGAGGAGGAAGTG GACGATTTGCCCGTCTTACCTTTAGTTATTGCACGTTGCTCTCCGCAGACTAAGGTGAGA ATGATCGAAGCTTTACACCGTAGGAAGAAGTTCTGCGCAATGACAGGTGACGGTGTTAAC GATTCTCCATCTCTAAAAATGGCCAATGTTGGTATTGCAATGGGTATTAATGGTTCAGAT GTTTCCAAAGAAGCGTCTGATATTGTTCTAAGCGATGACAATTTTGCTTCTATTTTGAAT GCTGTCGAAGAAGGTCGTAGGATGACGGATAACATTCAGAAGTTTGTCCTACAATTATTG GCAGAAAATGTTGCTCAGGCTTTGTATTTGATCATTGGTTTAGTATTCAGAGATGAGAAC GGAAAATCAGTATTTCCCTTATCACCAGTGGAAGTATTGTGGATTATTGTCGTCACCTCT TGTTTTCCTGCTATGGGGCTAGGTCTAGAAAAGGCTGCTCCAGATTTGATGGATAGACCT CCTAATGATTCAGAGGTTGGTATTTTCACATGGGAGGTTATTATAGATACATTTGCATAT GGGATTATAATGACAGGGTCCTGTATGGCTTCATTTACTGGATCACTGTATGGAATAAAT AGTGGTAGATTGGGGCACGATTGTGATGGCACCTATAACAGCAGTTGTCGTGATGTTTAT AGATCACGTTCTGCGGCTTTCGCAACTATGACGTGGTGCGCTTTGATTCTGGCTTGGGAA GTGGTTGACATGAGAAGATCTTTTTTCAGAATGCATCCAGACACTGACAGCCCAGTCAAG GAATTTTTCAGAAGTATTTGGGGAAACCAGTTTTTGTTCTGGTCAATCATTTTTGGATTT GTGTCAGCCTTCCCCGTCGTCTATATTCCGGTTATTAATGATAAAGTGTTTTTGCATAAA CCAATTGGTGCTGAATGGGGTCTCGCCATTGCATTCACAATTGCATTCTGGATAGGTGCT GAACTTTACAAGTGTGGAAAGAGGCGCTATTTCAAAACTCAGAGAGCTCACAATTCGGAA AACGATTTGGAGCGAAGCAGTAAACACGATCCATTTGAAGCGTATAGCACATCCACAACC CTTCAAAGCGAAATTAATATCAGTGTCAAGCATTAA
Protein Properties
Pfam Domain Function
Protein Residues1091
Protein Molecular Weight120295.0
Protein Theoretical pI5.19
Signalling Regions
  • None
Transmembrane Regions
  • 64-84
  • 91-111
  • 283-303
  • 313-333
  • 816-836
  • 849-869
  • 886-906
  • 944-964
  • 992-1012
  • 1022-1042
Protein Sequence>Sodium transport ATPase 5 MSEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKI DYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMN SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSD VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAY GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNSENDLERSSKHDPFEAYSTSTT LQSEINISVKH
References
External Links
ResourceLink
Saccharomyces Genome Database ENA5
Uniprot IDQ12691
Uniprot NameATN5_YEAST
GenBank Gene IDZ74334
Genebank Protein ID1431486
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956