You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFolylpolyglutamate synthase 1
Synonyms
  • Folylpoly-gamma-glutamate synthetase
  • FPGS
  • Tetrahydrofolylpolyglutamate synthase
  • Tetrahydrofolate synthase
Gene NameFOL3
Enzyme Class
Biological Properties
General FunctionInvolved in tetrahydrofolylpolyglutamate synthase activity
Specific FunctionConversion of folates to polyglutamate derivatives
Cellular LocationCytoplasm
SMPDB Pathways
tetrahydrofolate biosynthesisPW002417 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Folate biosynthesisec00790 Map00790
SMPDB Reactions
7,8-Dihydropteroic acid + Adenosine triphosphate + L-Glutamic acidADP + phosphate + hydron + 7,8-dihydrofolate monoglutamate
KEGG Reactions
Adenosine triphosphate + L-Glutamic acid + 7,8-Dihydropteroic acidphosphate + hydron + ADP + Dihydrofolic acid
Metabolites
YMDB IDNameView
YMDB00079Dihydrofolic acidShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB002937,8-Dihydropteroic acidShow
YMDB006677,8-dihydropteroateShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
YMDB162807,8-dihydrofolate monoglutamateShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
acid-amino acid ligase activity
tetrahydrofolylpolyglutamate synthase activity
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
Process
biosynthetic process
cellular metabolic process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
folic acid and derivative biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR113W
Gene Sequence>1284 bp ATGGCCATTGAATTGGGACTTTCCCGTATTACAAAACTACTAGAGCATTTAGGCAATCCG CAAAACTCACTTAGAGTGCTGCACATTGCAGGGACAAATGGTAAAGGTTCAGTATGTACT TACCTATCTTCTGTGTTGCAACAAAAGTCCTACCAAATTGGAAAATTTACCACTCCACAC TTGGTGCATGTTACTGATTCCATTACAATCAACAATAAGCCGATTCCGTTAGAGAGATAC CAGAATATTAGATTACAACTAGAAGCTTTAAACAAGTCACACTCTTTAAAATGTACGGAA TTCGAGCTATTAACATGTACCGCATTCAAATATTTTTATGATGTGCAGTGCCAATGGTGT GTCATAGAAGTAGGCCTTGGCGGAAGACTTGATGCGACCAATGTTATTCCAGGCGCAAAT AAGGCATGTTGTGGTATTACTAAAATCAGTTTGGATCATGAAAGCTTTTTAGGTAACACC TTGTCTGAAATCTCTAAAGAGAAAGCAGGTATAATAACAGAAGGGGTACCCTTCACAGTG ATTGATGGAACCAATGAGGCAAGTGTTATAAATGTTGTGAAAGAAAGATGCAAGGCTTTA GGGTCTGAACTATCCGTTACAGATTCTCAACTTAACGGAAATATGATTGACACCAACTCC TGGGGTTGTTTTGACTTGGCAAAATTGCCACTGAATGGAGAATATCAGATATTTAATCTC AGGGTGGCCATGGGTATGTTAGACTACTTACAAATGAACGAACTTATTGATATTACCAAG AATGAAGTAAGTACGAGATTGGCGAAGGTTGATTGGCCAGGAAGGTTATATCGTATGGAT TATCGCTTTGACAAAGTAAGTAATAGGACAGTGCCTATATTAATGGACGGTGCCCACAAT GGCTCAGCTGCAGTAGAGTTAGTTAAGTACCTAAGAAAGGAGTACGGAAACCAGCCTTTG ACCTTTGTGATGGCAGTAACGCATGGGAAAAACTTGGAGCCGCTGCTCCAGCCATTATTG AGGCCTATAGATCAAGTAATTCTTACTCGGTTTAATAATGTGGAAGGTATGCCCTGGATT CATGCCACTGATCCTGAAGAAATAAAAGATTTTATTTTGACTCAAGGATACACAAAGGAG ATAGTGATTGAAAATGATTTACATCAGGTATTGCCTTCTCTGGCGCATGTATCAGACGAG CAAAGACGGCCAATTGTTGTATGCGGTTCACTGTATTTATGTGGTGAATTATTACGGATT CACAATAGTCACTTGAGAAACTAA
Protein Properties
Pfam Domain Function
Protein Residues427
Protein Molecular Weight47850.80078
Protein Theoretical pI6.82
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Folylpolyglutamate synthase MAIELGLSRITKLLEHLGNPQNSLRVLHIAGTNGKGSVCTYLSSVLQQKSYQIGKFTTPH LVHVTDSITINNKPIPLERYQNIRLQLEALNKSHSLKCTEFELLTCTAFKYFYDVQCQWC VIEVGLGGRLDATNVIPGANKACCGITKISLDHESFLGNTLSEISKEKAGIITEGVPFTV IDGTNEASVINVVKERCKALGSELSVTDSQLNGNMIDTNSWGCFDLAKLPLNGEYQIFNL RVAMGMLDYLQMNELIDITKNEVSTRLAKVDWPGRLYRMDYRFDKVSNRTVPILMDGAHN GSAAVELVKYLRKEYGNQPLTFVMAVTHGKNLEPLLQPLLRPIDQVILTRFNNVEGMPWI HATDPEEIKDFILTQGYTKEIVIENDLHQVLPSLAHVSDEQRRPIVVCGSLYLCGELLRI HNSHLRN
References
External Links
ResourceLink
Saccharomyces Genome Database FOL3
Uniprot IDQ12676
Uniprot NameFOLD_YEAST
GenBank Gene IDZ49702
Genebank Protein ID817872
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Cherest, H., Thomas, D., Surdin-Kerjan, Y. (2000). "Polyglutamylation of folate coenzymes is necessary for methionine biosynthesis and maintenance of intact mitochondrial genome in Saccharomyces cerevisiae." J Biol Chem 275:14056-14063.10799479
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106